BioLiP

>protein
DEDPMTCDKLPKVPVPPLEEFIKSNPLQFAYVLTDTFDCTTRVYVQPARLSPNQAATALDIRGSRIITNDFVGGPNNSAI
LNNCTTGEKATWYFQYTNLNTPNGSSYCAYTCNGEEIAEYKCANNNNGTDPLQKQAVEVAKKVPNGDKIHYALDNCPEHH
GCFAFY

The query sequence (length=166) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7yax:A	166	166	1.0000	1.0000	1.0000	1.26e-124	7yax:B, 7yax:C, 7yax:D, 7ycb:A, 7ycb:B, 7ycb:C, 7ycb:D, 7ycd:A, 7ycd:B, 7ycd:C, 7ycd:D, 7ycf:A, 7ycf:B, 7ycf:C, 7ycf:D, 7yct:A, 7yct:B, 7yct:C, 7yct:D
2	6kfa:A	162	162	0.7108	0.7284	0.7284	2.52e-88	6kfb:A, 6kfd:A
3	7bpo:A	165	163	0.5241	0.5273	0.5337	4.59e-59	7bpo:B, 7br1:A, 7br1:B
4	7ry3:C	1048	119	0.1747	0.0277	0.2437	1.9	7m4p:B
5	3hqp:A	498	57	0.1145	0.0382	0.3333	4.9	3hqo:K, 3hqo:A, 3hqo:B, 3hqo:C, 3hqp:B, 3hqp:C, 3hqp:D, 3hqp:E, 3hqp:F, 3hqp:G, 3hqp:H, 3hqp:I, 3hqp:J, 3hqp:K, 3hqp:L, 3hqp:M, 3hqp:N, 3hqp:O, 3hqp:P, 3hqq:A, 3hqq:B, 3hqq:C, 3hqq:D, 3hqq:E, 3hqq:F, 3hqq:G, 3hqq:H, 3hqq:I, 3hqq:J, 3hqq:K, 3hqq:L, 3hqq:M, 3hqq:N, 3hqq:O, 3hqq:P, 3hqq:Q, 3hqq:R, 3hqq:S, 3hqq:T, 3hqq:U, 3hqq:V, 3hqq:W, 3hqq:X, 3pp7:B, 3qv6:A, 3qv7:D, 3qv7:A, 3qv8:D, 3srk:A
6	1sk8:A	435	63	0.0904	0.0345	0.2381	7.7	1sk9:A
7	7aat:A	401	35	0.0783	0.0324	0.3714	8.2	7aat:B, 8aat:A, 8aat:B, 9aat:A, 9aat:B, 1aka:A, 1aka:B, 1akb:A, 1akc:A, 1ama:A, 1ivr:A, 1map:A, 1maq:A, 1oxo:A, 1oxo:B, 1oxp:A, 1tar:A, 1tar:B, 1tas:A, 1tas:B, 1tat:A, 1tat:B
8	6b9o:B	937	86	0.1024	0.0181	0.1977	8.3	6b9o:A, 6b9p:A, 6b9p:B
9	7ttj:A	643	26	0.0602	0.0156	0.3846	9.7	7ttl:B, 3v99:A
10	7ttl:C	617	26	0.0602	0.0162	0.3846	9.8	6n2w:A, 6n2w:B

[Back]