DEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGG
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6evq:A | 70 | 70 | 1.0000 | 1.0000 | 1.0000 | 9.69e-46 | 6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B |
2 | 5m9e:B | 71 | 49 | 0.3143 | 0.3099 | 0.4490 | 5.11e-07 | 5m9e:A, 5m9e:C, 5m9e:D |
3 | 1qs0:A | 407 | 31 | 0.1857 | 0.0319 | 0.4194 | 0.62 | |
4 | 2wty:B | 97 | 27 | 0.1857 | 0.1340 | 0.4815 | 0.95 | 4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A |
5 | 6k02:B | 269 | 45 | 0.1857 | 0.0483 | 0.2889 | 1.2 | 6k02:A |
6 | 4eot:A | 92 | 27 | 0.2000 | 0.1522 | 0.5185 | 1.3 | 4eot:B |
7 | 1htw:A | 158 | 19 | 0.1571 | 0.0696 | 0.5789 | 2.3 | 1htw:B, 1htw:C |
8 | 1y7i:B | 262 | 37 | 0.1714 | 0.0458 | 0.3243 | 2.8 | 1xkl:A, 1xkl:B, 1xkl:C, 1xkl:D, 1y7i:A |
9 | 2dq0:A | 447 | 50 | 0.2000 | 0.0313 | 0.2800 | 4.0 | 2dq0:B, 2zr2:A, 2zr2:B |
10 | 7zm7:R | 98 | 53 | 0.2143 | 0.1531 | 0.2830 | 4.4 | 7zm8:R, 7zmb:R, 7zme:R, 7zmg:R, 7zmh:R |
11 | 1a05:A | 357 | 63 | 0.2571 | 0.0504 | 0.2857 | 8.5 | 1a05:B |