DDYLDRLPKSKKGLQGLLQDIEKRILHYKQLFFKEQNEIANGKRSMVPDNSIPICSDVTKLNFQALIDAQMRHAGKMFDV
IMMDPPWQDSLSDEKIQNMPIQSLQQDGFIFVWAINAKYRVTIKMIENWGYKLVDEITWVKAKESCLIGVKGDVDNGRFK
KNIASDVIFSERRGQSQKPEEIYQYINQLCPNGNYLEIFARRNNLHDNWVSIGNEL
The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7f4m:D | 216 | 216 | 1.0000 | 1.0000 | 1.0000 | 1.35e-162 | 7f4l:C, 7f4m:C, 7f4n:C, 7f4n:D |
2 | 7yi8:B | 223 | 223 | 0.9352 | 0.9058 | 0.9058 | 3.02e-145 | 7f4p:A, 7f4q:A, 7f4t:A, 7f4t:E, 7f4t:H, 7f4t:K, 7yi9:B |
3 | 5k7u:A | 208 | 189 | 0.3056 | 0.3173 | 0.3492 | 5.16e-32 | 7acd:A, 8bn8:AAA, 5il1:A, 5il2:A, 5k7w:A, 5l6d:A, 5l6e:A, 7nhg:A, 7nhh:A, 7nhi:A, 7nhj:A, 7nhv:A, 7ni7:A, 7ni8:A, 7ni9:A, 7nia:A, 7nid:A, 7o08:A, 7o09:A, 7o0l:A, 7o0m:A, 7o0p:A, 7o0q:A, 7o0r:A, 7o27:A, 7o28:A, 7o29:A, 7o2e:A, 7o2f:A, 7o2h:A, 7o2i:A, 7o2x:A, 7oed:A, 7oee:A, 7oef:A, 7oeg:A, 7oeh:A, 7oei:A, 7oej:A, 7oek:A, 7oel:A, 7oem:A, 7oql:A, 7oqo:A, 7oqp:A, 8pw8:A, 8pw9:A, 8pwa:A, 8pwb:A, 5tey:A, 6ttp:A, 6ttt:A, 6ttv:A, 6ttw:A, 6ttx:A, 6tu1:A, 6y4g:A |
4 | 7ni7:B | 246 | 195 | 0.2361 | 0.2073 | 0.2615 | 8.65e-14 | 7acd:B, 7nhh:B, 7o0q:B, 7oem:B, 8pwa:B |
5 | 7cv9:A | 356 | 210 | 0.2407 | 0.1461 | 0.2476 | 1.46e-05 | 7cv6:B, 7cv7:A, 7cv7:B |
6 | 7cv9:C | 351 | 220 | 0.2361 | 0.1453 | 0.2318 | 1.38e-04 | 7cv8:A, 7dpe:A |
7 | 8kdb:A | 2117 | 102 | 0.1157 | 0.0118 | 0.2451 | 0.094 | 8kdc:A |
8 | 1flg:A | 582 | 66 | 0.0926 | 0.0344 | 0.3030 | 1.2 | 1flg:B |
9 | 5ybb:A | 487 | 46 | 0.0602 | 0.0267 | 0.2826 | 1.2 | 5ybb:B |
10 | 7myv:B | 239 | 78 | 0.0972 | 0.0879 | 0.2692 | 1.4 | 7myv:A |
11 | 8w1o:K | 1290 | 96 | 0.1157 | 0.0194 | 0.2604 | 1.5 | |
12 | 8c56:A | 388 | 135 | 0.1481 | 0.0825 | 0.2370 | 1.7 | 8c57:A, 8c58:A, 8c59:A, 4dkj:A |
13 | 4h83:F | 368 | 91 | 0.1065 | 0.0625 | 0.2527 | 2.2 | 4h83:A, 3no1:A, 3no1:B, 3no1:C, 3no1:D, 3no1:E, 3no1:F |
14 | 3bry:A | 389 | 129 | 0.1435 | 0.0797 | 0.2403 | 2.7 | 3bry:B |
15 | 3fxb:A | 310 | 86 | 0.0787 | 0.0548 | 0.1977 | 3.0 | 3fxb:B |
16 | 7lcc:A | 1369 | 41 | 0.0648 | 0.0102 | 0.3415 | 5.5 |