DDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERD
AYKVK
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wty:B | 97 | 85 | 1.0000 | 0.8763 | 1.0000 | 4.15e-57 | 4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A |
2 | 4eot:A | 92 | 85 | 0.8235 | 0.7609 | 0.8235 | 7.27e-44 | 4eot:B |
3 | 7x5e:E | 101 | 85 | 0.5882 | 0.4950 | 0.5882 | 2.35e-30 | 3a5t:A, 3a5t:B, 7x5e:A, 7x5f:A, 7x5f:E, 7x5g:A, 7x5g:E |
4 | 6evq:A | 70 | 27 | 0.1529 | 0.1857 | 0.4815 | 1.2 | 6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B |
5 | 7x5e:B | 106 | 80 | 0.2235 | 0.1792 | 0.2375 | 1.4 | 7x5e:F, 7x5f:B, 7x5f:F, 7x5g:B, 7x5g:F |
6 | 5vpe:D | 67 | 61 | 0.2353 | 0.2985 | 0.3279 | 2.2 | 5vpe:B, 5vpf:B, 5vpf:D |
7 | 4oht:A | 455 | 38 | 0.1647 | 0.0308 | 0.3684 | 2.8 | 4oht:B, 4ywu:A, 4ywu:B, 4ywv:A, 4ywv:B |
8 | 4par:C | 314 | 87 | 0.2353 | 0.0637 | 0.2299 | 4.2 | 4par:B, 4par:A, 4par:D, 4pba:C, 4pba:B, 4pba:A, 4pba:D |
9 | 6d6v:A | 980 | 74 | 0.2353 | 0.0204 | 0.2703 | 5.1 | 5c9h:B |
10 | 8gap:A | 1012 | 74 | 0.2353 | 0.0198 | 0.2703 | 5.3 | 5c9h:A, 7lma:A, 7lmb:A, 7uy5:A, 7uy6:A |
11 | 7pt6:9 | 341 | 34 | 0.1294 | 0.0323 | 0.3235 | 5.7 | 7pt6:I, 7pt7:9 |