DDPVKVRKWKHVQMEKIRRINTKEAFERLIKSVRTPPKENGKRIPKHILLTCVMNDIKSIRSANEALQHILDD
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xq5:B | 73 | 73 | 1.0000 | 1.0000 | 1.0000 | 2.87e-49 | |
2 | 7zy4:B | 306 | 40 | 0.1644 | 0.0392 | 0.3000 | 1.7 | 7zy4:A |
3 | 6lu0:A | 937 | 30 | 0.1507 | 0.0117 | 0.3667 | 1.9 | |
4 | 7s0z:C | 179 | 16 | 0.1233 | 0.0503 | 0.5625 | 2.9 | 2fn4:A, 7s0z:D |
5 | 6ltr:A | 1037 | 28 | 0.1507 | 0.0106 | 0.3929 | 5.8 | 6ltu:A |
6 | 4z5q:A | 363 | 54 | 0.1781 | 0.0358 | 0.2407 | 6.7 | |
7 | 8dh5:M | 740 | 46 | 0.1918 | 0.0189 | 0.3043 | 8.5 | |
8 | 8dh3:E | 825 | 46 | 0.1918 | 0.0170 | 0.3043 | 9.6 | 8dh4:M, 8dh5:E |
9 | 8cbc:A | 455 | 37 | 0.1644 | 0.0264 | 0.3243 | 9.6 | 8c48:A, 8c48:B, 8cbc:B, 7o0e:A, 7o0e:G, 8p67:A, 8p67:B |