DAGTVDFYGQLRTELKFLEDKDPTIGSGSSRAGVDANYTVNDSLALQGKVEFALKDSGDMYVRNHILGVKTNFGKFSFGK
QWTTSDDVYGADYSYFFGGTGLRYGTLSDALHDSQVKYVYEADSFWVKAGYGFPEDNAKQELAELYVGATFGDLAVHAGG
GQNRDKAFKVGSNTVGTTTTDIKADVTNSYFEVTGEYTIGDALIGVTYYNAELDVENNPLVIDEDAISVAGTYKVADKTK
LYAGYEYVMQEANTGADEDGTLVYLGVEYKFASWARVYAEYGYGDGTTDSANNFGIGARYYW
The query sequence (length=302) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ehd:A | 322 | 319 | 0.9901 | 0.9286 | 0.9373 | 0.0 | 6ehe:A, 6ehf:A |
2 | 8pyz:F | 347 | 87 | 0.0828 | 0.0720 | 0.2874 | 1.4 | 5nup:A, 5nup:B, 5nup:C, 5o79:C, 5o79:A, 5o79:B, 8pyz:E, 8pyz:C, 7q3t:A, 7q3t:B, 7q3t:C, 7q3t:E, 7q3t:D, 7q3t:F, 6rck:C, 6rd3:A, 6rd3:B, 6rd3:C, 6rd3:D, 6rd3:E, 6rd3:F, 7szi:C |
3 | 5ymr:B | 798 | 87 | 0.0927 | 0.0351 | 0.3218 | 1.8 | 5ymr:D, 5ymr:C, 5ymr:A |
4 | 5w7c:C | 420 | 60 | 0.0530 | 0.0381 | 0.2667 | 2.0 | 5w78:B, 5w7c:D |
5 | 6km9:B | 845 | 88 | 0.0762 | 0.0272 | 0.2614 | 3.5 | 6km9:A, 6kma:A, 6kma:B, 6kma:C, 6kma:D |