CVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLADIECRAAQLPDMPLEELGQQVDCDRMRGLMCANSQQ
SPPLCHDYELRVLCCEYVPC
The query sequence (length=100) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8oer:I | 100 | 100 | 1.0000 | 1.0000 | 1.0000 | 3.39e-71 | 8oer:J, 8oes:I, 8oes:J, 8oes:K, 8oes:L, 8oes:M, 8oes:N |
| 2 | 8ov0:A | 110 | 96 | 0.4000 | 0.3636 | 0.4167 | 2.35e-21 | |
| 3 | 8s03:A | 100 | 100 | 0.3700 | 0.3700 | 0.3700 | 1.62e-16 | |
| 4 | 7a5o:A | 1205 | 94 | 0.3900 | 0.0324 | 0.4149 | 1.57e-15 | 7a5o:B, 7a5o:C, 7a5o:D, 7a5o:E, 7a5o:F, 7a5o:G, 7a5o:H, 7a5o:I, 7a5o:J, 8ck2:A, 7pov:A, 7pov:B, 7pov:C, 7pov:D, 7pp6:A, 7pp6:B, 7pp6:C, 7pp6:D, 7pp6:E, 7pp6:G, 7prl:A, 6rbf:A, 6rbf:B, 6rbf:C, 6rbf:D, 6tm2:A, 6tm2:B, 6tm2:C, 6tm2:D, 6tm2:E, 6tm2:F, 6tm6:A |
| 5 | 1tll:A | 630 | 67 | 0.1900 | 0.0302 | 0.2836 | 1.3 | 1f20:A, 1tll:B |
| 6 | 5wd6:A | 195 | 31 | 0.1100 | 0.0564 | 0.3548 | 2.7 | 6o1t:A, 6o1t:B |
| 7 | 8c6j:D | 123 | 19 | 0.0900 | 0.0732 | 0.4737 | 3.6 | 9fmd:1, 6icz:X, 6qdv:D, 7w5a:2, 7w5b:2, 5xjc:X |
| 8 | 4er0:A | 315 | 33 | 0.1300 | 0.0413 | 0.3939 | 4.6 | |
| 9 | 3uwp:A | 341 | 33 | 0.1300 | 0.0381 | 0.3939 | 4.6 | 7bwd:K, 5drt:A, 5drt:B, 5dry:A, 5dry:B, 5dsx:A, 5dsx:B, 5dt2:A, 5dt2:B, 5dtm:A, 5dtm:B, 5dtq:A, 5dtq:B, 5dtr:A, 5dtr:B, 4ek9:A, 4ekg:A, 4eki:A, 4eqz:A, 4er3:A, 4er5:A, 4er6:A, 4er7:A, 4hra:A, 6in3:A, 6j99:K, 6jm9:X, 6jma:X, 5juw:A, 5mvs:A, 5mvs:B, 5mw3:A, 5mw3:B, 5mw4:A, 5mw4:B, 6nj9:K, 6nj9:M, 6nqa:K, 1nw3:A, 6o96:K, 3qow:A, 3qox:A, 3sr4:A, 3sx0:A, 6te6:A, 6te6:B, 6tel:A, 6tel:B, 6ten:A, 6ten:B, 4wvl:A, 7xcr:K, 7xct:K, 7xct:M |
umich.edu