CTSIVAQDSRGHVYHGRNLDYPYGSILRKLTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDRGWWWENL
VAALFLRHSPISWLLRTTLSEAESFEAAVYRLAKTPLIADVYYIVGGTNPREGVVITRNRDGPADIWPLDPLKGVWFLVE
TNYDHWKPAPEEDDRRTPAIKALNATGQAKLSLETLFQVLSVVPVYNNYTIYTTVMSAASPDKYMTRIRNP
The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6dy0:B | 231 | 231 | 1.0000 | 1.0000 | 1.0000 | 2.41e-174 | 6dxz:B |
2 | 6dxx:B | 231 | 231 | 0.8831 | 0.8831 | 0.8831 | 4.56e-158 | 6dxx:D, 6dxx:F |
3 | 6dy2:B | 232 | 231 | 0.8442 | 0.8405 | 0.8442 | 7.21e-150 | 6dy2:D |
4 | 6mhm:B | 253 | 246 | 0.4156 | 0.3794 | 0.3902 | 6.39e-52 | 6mhm:D |
5 | 5u81:A | 369 | 235 | 0.3939 | 0.2466 | 0.3872 | 1.78e-47 | |
6 | 5u84:B | 353 | 244 | 0.3766 | 0.2465 | 0.3566 | 1.24e-45 | 5u84:A |
7 | 5gug:A | 1721 | 128 | 0.1169 | 0.0157 | 0.2109 | 2.1 | 5gug:B, 1n4k:A, 3t8s:B, 3uj0:A, 3uj0:B, 5xa1:A, 5xa1:B |
8 | 8etk:A | 321 | 45 | 0.0736 | 0.0530 | 0.3778 | 3.9 | 8etk:B, 8ewt:A, 8ewt:B, 7svg:A, 7svg:D |
9 | 8qlp:B | 452 | 35 | 0.0649 | 0.0332 | 0.4286 | 4.7 | 8qlp:F, 8qlp:J, 8qlp:N |
10 | 8esi:A | 316 | 29 | 0.0519 | 0.0380 | 0.4138 | 5.4 | 8esi:B, 8esi:C, 8esi:D, 8esi:E, 8esi:F, 8esi:G, 8esi:H, 8ete:A, 8ete:B |