CKRGHICVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRM
RDWLKNILMQLYEANGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHPMDRVLTHSELAPLRASLVPMEHCITRFFEEC
DPNKDKHITLKEWGHCFGIKEEDIDENLLFAS
The query sequence (length=192) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7kbu:A | 221 | 214 | 0.9844 | 0.8552 | 0.8832 | 7.43e-137 | 7kbu:B |
2 | 1bmo:A | 233 | 212 | 0.6302 | 0.5193 | 0.5708 | 7.75e-88 | 1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A |
3 | 2p6a:C | 282 | 60 | 0.1042 | 0.0709 | 0.3333 | 0.004 | 1lr7:A, 1lr8:A |
4 | 2p6a:C | 282 | 42 | 0.0833 | 0.0567 | 0.3810 | 0.42 | 1lr7:A, 1lr8:A |
5 | 2p6a:C | 282 | 48 | 0.0938 | 0.0638 | 0.3750 | 0.77 | 1lr7:A, 1lr8:A |
6 | 3hzt:A | 421 | 161 | 0.2188 | 0.0998 | 0.2609 | 1.9 | |
7 | 2jul:A | 181 | 33 | 0.0625 | 0.0663 | 0.3636 | 2.0 | 2e6w:A |
8 | 5ey5:B | 383 | 32 | 0.0625 | 0.0313 | 0.3750 | 3.4 | 5ey5:D |
9 | 7d6v:B | 239 | 32 | 0.0625 | 0.0502 | 0.3750 | 4.6 | 7d6x:B |
10 | 3dd4:A | 214 | 86 | 0.1146 | 0.1028 | 0.2558 | 4.8 | |
11 | 8vhh:A | 389 | 96 | 0.1198 | 0.0591 | 0.2396 | 4.9 | 8egy:A, 8egy:B, 8egz:A, 8egz:B, 8eh0:A, 8eh0:B, 8eh1:A, 8eh1:B, 8vhh:B |
12 | 2xrc:B | 485 | 43 | 0.0781 | 0.0309 | 0.3488 | 5.3 | 5o32:D, 5o32:H, 2xrc:A, 2xrc:D |
13 | 2xrc:C | 454 | 43 | 0.0781 | 0.0330 | 0.3488 | 5.5 | |
14 | 5tci:H | 406 | 36 | 0.0677 | 0.0320 | 0.3611 | 7.6 | 6dwe:B, 6dwe:H, 6dwe:F, 6dwe:D, 6e9p:B, 6e9p:D, 6e9p:F, 6e9p:H, 5ocw:B, 5ocw:D, 5ocw:F, 5ocw:H, 5ocw:J, 5ocw:L, 5ocw:N, 5ocw:P, 5ocw:R, 5ocw:T, 5ocw:V, 5ocw:X, 5tcg:B, 5tcg:H, 5tcg:F, 5tcg:D, 5tci:B, 5tci:F, 5tci:D, 5tcj:B, 5tcj:H, 5tcj:F, 5tcj:D, 6u6c:B, 6u6c:D, 6u6c:F, 6u6c:H, 6uap:B, 6uap:D, 6uap:F, 6uap:H, 6ub9:B, 6ub9:D, 6ub9:F, 6ub9:H, 6usa:B, 6usa:D, 6usa:F, 6usa:H |
15 | 2scp:A | 174 | 24 | 0.0521 | 0.0575 | 0.4167 | 7.9 | 2scp:B |