Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
CCLWSDWINEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQHGQKVQCDVSVGFICKNEDQFGNGPFGLCYD
YKIRVNCCWP

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7a5o:A 1205 90 1.0000 0.0747 1.0000 1.74e-58 7a5o:B, 7a5o:C, 7a5o:D, 7a5o:E, 7a5o:F, 7a5o:G, 7a5o:H, 7a5o:I, 7a5o:J, 8ck2:A, 7pov:A, 7pov:B, 7pov:C, 7pov:D, 7pp6:A, 7pp6:B, 7pp6:C, 7pp6:D, 7pp6:E, 7pp6:G, 7prl:A, 6rbf:A, 6rbf:B, 6rbf:C, 6rbf:D, 6tm2:A, 6tm2:B, 6tm2:C, 6tm2:D, 6tm2:E, 6tm2:F, 6tm6:A
2 8ov0:A 110 97 0.4333 0.3545 0.4021 1.69e-20
3 8s03:A 100 91 0.4333 0.3900 0.4286 1.09e-18
4 8oer:I 100 94 0.4333 0.3900 0.4149 4.47e-17 8oer:J, 8oes:I, 8oes:J, 8oes:K, 8oes:L, 8oes:M, 8oes:N
5 4oal:A 444 26 0.1333 0.0270 0.4615 3.1 4oal:B
6 8ia0:CZ 576 23 0.1222 0.0191 0.4783 3.7
7 7cnp:A 559 38 0.1333 0.0215 0.3158 4.4 7cnp:B, 7cnp:C, 7cnq:A, 7cnq:B, 7cnq:C, 7cnq:D, 7d2r:A
8 6hiy:DA 1426 32 0.1222 0.0077 0.3438 4.8
9 6hiv:DA 1557 32 0.1222 0.0071 0.3438 4.8 6hiw:DA, 7pub:DA
10 7y7b:c 215 43 0.1556 0.0651 0.3256 6.8
11 8esq:m 572 21 0.1333 0.0210 0.5714 7.1 8esr:m, 8etg:m, 8eti:m, 8eug:m, 8eui:m

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417