CCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFC
QVRLN
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 9b8o:f | 86 | 85 | 1.0000 | 0.9884 | 1.0000 | 6.56e-59 | 9brd:f, 6wlw:T, 6wm2:T |
2 | 4ptv:A | 445 | 53 | 0.2000 | 0.0382 | 0.3208 | 4.5 | 4ptv:B, 4ptw:A, 4ptw:B, 4ptx:A, 4ptx:B |
3 | 3u9j:A | 157 | 51 | 0.2000 | 0.1083 | 0.3333 | 8.2 | 3u9j:B, 3u9m:A, 3u9m:C, 3u9m:E, 3u9m:G, 3v5x:A, 3v5x:B, 3v5y:A, 3v5y:B, 3v5y:C, 3v5y:D, 3v5z:A, 3v5z:B |