Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
CAEFRIKYVGAILDLINYIKLPFVPPEEEFIMGVSKYGIKVSTSALYLIIRMVCYDSLLALKTTYSLWVYQCNSLEQAQA
ICKVLSTAFDSVL

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4dx9:y 93 93 1.0000 1.0000 1.0000 1.17e-64
2 4dx9:0 110 111 0.9677 0.8182 0.8108 5.77e-51 4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U
3 4jif:A 130 130 0.9892 0.7077 0.7077 7.24e-50 4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y
4 4dx9:O 102 108 0.8710 0.7941 0.7500 1.89e-44 4dx9:a
5 4dx9:2 91 97 0.8280 0.8462 0.7938 3.95e-41
6 4dx9:o 63 89 0.5806 0.8571 0.6067 4.85e-20
7 2bgu:A 328 48 0.1935 0.0549 0.3750 2.1
8 7cvp:A 254 41 0.1075 0.0394 0.2439 7.1
9 1h54:B 754 16 0.0860 0.0106 0.5000 8.1

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218