BioLiP

>protein
CAEFRIKYVGAIEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTLHRHALIIRMVCYDDGKSLLALKTTYS
LWVYQCNSLEQAQAICKVLSTAFDS

The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4dx9:0	110	110	0.9714	0.9273	0.9273	7.00e-66	4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U
2	4jif:A	130	129	1.0000	0.8077	0.8140	3.21e-64	4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y
3	4dx9:O	102	113	0.8857	0.9118	0.8230	4.72e-55	4dx9:a
4	4dx9:y	93	105	0.8286	0.9355	0.8286	1.99e-51
5	4dx9:2	91	107	0.8095	0.9341	0.7944	6.95e-46
6	4dx9:o	63	103	0.5429	0.9048	0.5534	1.36e-17
7	6st5:A	913	30	0.1143	0.0131	0.4000	0.28
8	6yxx:ED	598	55	0.1619	0.0284	0.3091	1.0	7aoi:XC, 6yxy:ED
9	5o1n:A	442	52	0.1429	0.0339	0.2885	2.7	5l78:A, 5l78:B, 5o1o:A, 5o1o:B
10	4fo0:A	502	24	0.0952	0.0199	0.4167	3.2
11	6tgv:C	389	37	0.1333	0.0360	0.3784	4.7	8ow5:A, 8ow5:B, 8ow5:C, 8ow5:D, 8owb:A, 8owb:B, 8owb:C, 8owb:D, 8owp:A, 8owp:B, 8owp:C, 8owp:D, 8owq:A, 8owq:B, 8owq:C, 8owq:D, 8owr:A, 8owr:C, 8owr:D, 4qji:A, 4qji:B, 6tgv:A, 6tgv:B, 6tgv:D, 6th2:A, 6th2:C, 6thc:A, 6thc:B, 6thc:C, 6thc:D
12	8unf:A	187	49	0.1524	0.0856	0.3265	5.4	3u5z:A, 3u5z:K, 3u60:A, 8uh7:A, 8uk9:A, 8uk9:Q
13	3a31:A	465	28	0.0952	0.0215	0.3571	6.3	3a32:A
14	6nf1:A	550	42	0.1238	0.0236	0.3095	6.9	3bji:A, 3bji:B, 3ky9:A, 3ky9:B, 6new:A, 6nfa:A, 2vrw:B
15	2rgo:B	530	30	0.1048	0.0208	0.3667	8.2
16	2rgo:A	557	30	0.1048	0.0197	0.3667	8.2	2rgh:A
17	3o0h:B	459	63	0.1810	0.0414	0.3016	9.7	3o0h:A

[Back]