CAEFGPLDLINYIDLPFVPMGVSGIKVRMVCYDSLLALKTTDAYSLWVYQLEQAQAICDSVLT
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4dx9:o | 63 | 63 | 1.0000 | 1.0000 | 1.0000 | 2.80e-42 | |
2 | 4dx9:y | 93 | 89 | 0.8571 | 0.5806 | 0.6067 | 3.28e-20 | |
3 | 4dx9:2 | 91 | 94 | 0.8571 | 0.5934 | 0.5745 | 4.55e-17 | |
4 | 4dx9:O | 102 | 81 | 0.7619 | 0.4706 | 0.5926 | 1.26e-16 | 4dx9:a |
5 | 4jif:A | 130 | 106 | 0.8730 | 0.4231 | 0.5189 | 2.00e-16 | 4dx9:m, 4dx9:1, 4dx9:C, 4dx9:G, 4dx9:E, 4dx9:I, 4dx9:4, 4dx9:K, 4dx9:5, 4dx9:M, 4dx9:c, 4dx9:e, 4dx9:g, 4dx9:Q, 4dx9:S, 4dx9:W, 4dx9:Y |
6 | 4dx9:0 | 110 | 114 | 0.9365 | 0.5364 | 0.5175 | 1.02e-15 | 4dx9:k, 4dx9:3, 4dx9:A, 4dx9:s, 4dx9:u, 4dx9:i, 4dx9:U |
7 | 4eei:B | 423 | 31 | 0.2063 | 0.0307 | 0.4194 | 0.75 | 4eei:A, 5hw2:A, 5hw2:C |
8 | 1kfd:A | 560 | 56 | 0.2698 | 0.0304 | 0.3036 | 6.2 | |
9 | 1kv9:A | 664 | 60 | 0.2381 | 0.0226 | 0.2500 | 9.2 | |
10 | 5w1h:A | 1301 | 14 | 0.1270 | 0.0061 | 0.5714 | 9.8 | 5w1i:A, 5w1i:C, 5wlh:A |
11 | 7w7g:A | 1528 | 32 | 0.1746 | 0.0072 | 0.3438 | 9.9 |