Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
AVPKRRMSRANTRSRRAQWKAEAPGLVTVSVAGQQRKVPRRLLKAARLGLVDLD

The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 5xym:0 55 54 1.0000 0.9818 1.0000 2.88e-32 6dzi:b, 6dzp:b, 8fr8:8, 8kab:b, 5o60:b, 5o61:b, 7s0s:c, 8v9j:4, 8v9k:4, 8v9l:4, 8whx:5, 8why:5, 8wi7:5, 8wi8:5, 8wib:5, 8wic:5, 7xam:b, 8xz3:b, 7y41:b, 5zeb:3, 5zep:z, 5zet:3
2 7kgb:0 54 54 0.7407 0.7407 0.7407 1.48e-13 7f0d:0, 7msc:0, 7msh:0, 7msm:0, 7msz:0, 7mt2:0, 7mt3:0, 7mt7:0, 7sfr:0, 5v7q:0, 5v93:0
3 9c4g:z 62 30 0.3704 0.3226 0.6667 1.75e-07 8crx:z, 8cvm:z
4 5li0:4 56 46 0.2963 0.2857 0.3478 5.66e-05 7asm:Z, 7asn:b, 7aso:g, 7asp:Z, 6ddd:N, 6ddg:N, 6fxc:AZ, 6fxc:BZ, 5hkv:Z, 5hl7:Z, 6hma:Z, 5nd8:4, 5nd9:4, 5ngm:AZ, 7nhl:5, 7nhm:5, 5nrg:Z, 8p2f:5, 8p2g:5, 8p2h:5, 7p48:Z, 6s0x:Z, 6s0z:Z, 6s12:Z, 6s13:Z, 5t7v:LE, 5tcu:LE, 7ttu:N, 7ttw:N, 4wce:Z, 4wf9:Z, 4wfa:Z, 4wfb:Z, 6wqn:N, 6wqq:N, 6wrs:N, 6wru:N, 8y36:Z, 8y37:Z, 8y38:Z, 8y39:Z, 6yef:4
5 3j3v:0 55 46 0.3148 0.3091 0.3696 8.71e-04 7aqc:b, 7aqd:b, 7as8:f, 7as9:f, 8buu:0, 6ha1:0, 6ha8:0, 6htq:1, 3j3w:0, 3j9w:B4, 5njt:p, 7o5b:0, 7ope:f, 6ppf:b, 6ppk:b, 6pvk:b, 8qcq:0, 7qgu:b, 7qh4:b, 8qpp:0, 7qv1:0, 7qv2:0, 7qv3:0, 8r55:0, 8s1p:0, 8s1u:0, 7s9u:b, 7sae:b, 6tnn:p, 6tpq:p
6 8a57:5 53 36 0.2963 0.3019 0.4444 0.001 8a5i:5, 8a63:5, 7nhn:5, 8uu4:4, 8uu5:4, 8uu6:4, 8uu7:4, 8uu8:4, 8uu9:4, 8uua:4
7 6sj6:4 34 27 0.2222 0.3529 0.4444 0.025
8 7jil:b 59 57 0.2778 0.2542 0.2632 1.3
9 7jzw:B 306 37 0.2222 0.0392 0.3243 4.8 6b44:B, 6b45:B, 6b47:B, 6b48:B, 7ecv:B, 7ecw:B, 7elm:B, 7elm:L, 7eln:B, 7eln:L, 7eqg:C, 7jzx:B, 7jzy:B, 7jzz:B, 6ne0:B, 7t3j:B, 7t3k:B, 7t3k:b, 7t3l:B, 7t3l:b, 7taw:B, 7taw:b, 7tax:B, 5uz9:B, 6vqv:D, 6vqw:C, 6vqx:C, 6w1x:B, 7we6:B, 7we6:L, 6whi:B, 7yhs:E
10 3ez2:B 394 27 0.2037 0.0279 0.4074 8.1 3ez2:A, 3ez6:A, 3ez6:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417