AVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVG
The query sequence (length=94) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4mhv:A |
94 |
94 |
1.0000 |
1.0000 |
1.0000 |
3.80e-66 |
|
2 |
2qb0:B |
241 |
67 |
0.3191 |
0.1245 |
0.4478 |
5.58e-12 |
2qb0:D |
3 |
9feh:A |
264 |
67 |
0.3191 |
0.1136 |
0.4478 |
1.67e-10 |
8bwu:A, 8e1f:D, 8frj:A, 8frk:A, 2qb0:C, 7tw7:A, 7tw8:A, 7tw9:A |
4 |
7n1o:A |
257 |
67 |
0.3085 |
0.1128 |
0.4328 |
2.97e-10 |
8fz4:A, 8fz4:B, 8fzv:A, 1sht:X, 1shu:X, 1t6b:Y, 1tzn:a, 1tzn:b, 1tzn:c, 1tzn:d, 1tzn:e, 1tzn:f, 1tzn:g, 1tzn:h, 1tzn:i, 1tzn:j, 1tzn:k, 1tzn:l, 1tzn:m, 1tzn:o |
5 |
4a3u:A |
355 |
22 |
0.1170 |
0.0310 |
0.5000 |
1.3 |
4a3u:B |
6 |
4ot7:A |
308 |
22 |
0.1170 |
0.0357 |
0.5000 |
1.4 |
|
7 |
8u87:A |
621 |
55 |
0.1809 |
0.0274 |
0.3091 |
2.9 |
8u7y:A, 8u7y:B, 8u85:A, 8u85:C, 8u86:A, 8u86:C, 8u87:C |
8 |
6qfb:C |
1011 |
62 |
0.2021 |
0.0188 |
0.3065 |
3.5 |
|
9 |
8g1e:A |
1037 |
62 |
0.2021 |
0.0183 |
0.3065 |
3.5 |
8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D |
10 |
5u9c:A |
288 |
41 |
0.1383 |
0.0451 |
0.3171 |
6.9 |
5u9c:C |
11 |
4tmc:A |
399 |
17 |
0.0745 |
0.0175 |
0.4118 |
9.3 |
4tmb:A, 4tmb:B, 4tmb:C, 4tmb:D, 4tmc:B, 4tmc:C, 4tmc:D |