BioLiP

>protein
AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHVGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD
DR

The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1hko:A	104	82	0.9878	0.7788	0.9878	1.08e-56	1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A
2	2i96:A	108	82	0.9512	0.7222	0.9512	1.12e-54	4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A
3	1aw3:A	94	81	0.9146	0.7979	0.9259	5.37e-52	1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A
4	3ozz:B	82	82	0.8415	0.8415	0.8415	3.28e-49
5	2i89:A	90	81	0.7073	0.6444	0.7160	2.42e-41	2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B
6	1awp:A	86	81	0.5976	0.5698	0.6049	7.11e-35	1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A
7	3ner:B	91	81	0.6098	0.5495	0.6173	8.48e-34	3ner:A
8	2ibj:A	86	81	0.5854	0.5581	0.5926	1.73e-30
9	4b8n:B	90	74	0.3659	0.3333	0.4054	2.65e-12	4b8n:A, 4b8n:C, 4b8n:D
10	1cxy:A	81	80	0.3049	0.3086	0.3125	6.82e-11
11	3lf5:A	87	72	0.2927	0.2759	0.3333	9.53e-11	3lf5:B
12	1kbi:A	504	49	0.2683	0.0437	0.4490	1.39e-09	1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B
13	1x3x:A	82	66	0.3049	0.3049	0.3788	3.89e-09	1x3x:B
14	8tgb:A	108	76	0.2683	0.2037	0.2895	7.04e-09	8tgb:B
15	7bwh:A	88	79	0.2927	0.2727	0.3038	1.16e-08
16	1sox:A	463	81	0.3415	0.0605	0.3457	5.58e-06	2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B
17	1mj4:A	79	73	0.2805	0.2911	0.3151	7.27e-05
18	1k6m:A	432	48	0.1463	0.0278	0.2500	2.1	1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B
19	5lvf:A	142	24	0.1341	0.0775	0.4583	3.9	2l0i:A, 5m9d:A
20	2d2c:D	168	24	0.1341	0.0655	0.4583	4.0	2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q
21	8dyu:A	2562	29	0.1341	0.0043	0.3793	5.8	8dyv:A
22	8fcy:A	2864	29	0.1341	0.0038	0.3793	6.1	8fd6:A, 8fdt:A
23	8pqw:A	2892	29	0.1341	0.0038	0.3793	6.2	8pqy:A, 8pqz:A, 8pqz:J
24	5nug:A	2920	29	0.1341	0.0038	0.3793	6.3	5nug:B
25	7z8g:A	3047	29	0.1341	0.0036	0.3793	6.8	8fdu:A, 7z8l:f
26	8ptk:f	4502	29	0.1341	0.0024	0.3793	7.9	8ptk:e
27	7unj:A	218	17	0.0976	0.0367	0.4706	8.1	7unj:B
28	7z8f:e	4579	29	0.1341	0.0024	0.3793	8.3	5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A

[Back]