AVINHDAVPVWPQPEPADATQALAVRFKPQLDVVNGCQPYPAVDPQGNTSGGLKPAAACRDMSKAQVYSRSGTYNGYYAI
MYSWYMPKDSPSTGIGHRHDWENVVVWLDNAASANIVALSASAHGYKKSFPADKSYLDGITAKISYKSTWPLDHELGFTT
SAGKQQPLIQWEQMTQAARDALESTDFGNANVPFKSNFQDKLVKAFFQ
The query sequence (length=208) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5no9:B | 212 | 212 | 1.0000 | 0.9811 | 0.9811 | 1.08e-153 | 3gnz:P, 5nnw:A, 5nnw:B, 5nnw:C, 5nnw:D, 5no9:A, 5no9:C, 5no9:D, 6qbd:A, 6qbd:B |
2 | 3st1:A | 212 | 204 | 0.4231 | 0.4151 | 0.4314 | 1.62e-46 | |
3 | 6xyw:Ab | 155 | 51 | 0.0817 | 0.1097 | 0.3333 | 0.26 | |
4 | 8c00:t | 619 | 149 | 0.1538 | 0.0517 | 0.2148 | 0.53 | 8c01:t, 6rbd:k, 7wtr:CC |
5 | 4wrn:A | 693 | 84 | 0.0913 | 0.0274 | 0.2262 | 1.1 | 7pfp:B |
6 | 4wrn:B | 663 | 84 | 0.0913 | 0.0287 | 0.2262 | 1.3 | |
7 | 7pfp:A | 563 | 84 | 0.0913 | 0.0337 | 0.2262 | 1.3 | 7pfp:C, 7q3n:U |
8 | 7wtp:CC | 661 | 149 | 0.1538 | 0.0484 | 0.2148 | 2.1 | 6eml:t, 6wdr:k, 7wtq:CC |
9 | 8cbj:k | 670 | 149 | 0.1538 | 0.0478 | 0.2148 | 2.5 | 6fai:k, 6y7c:t |
10 | 7trc:K | 330 | 45 | 0.0769 | 0.0485 | 0.3556 | 3.3 | 7bgb:K |
11 | 5na8:A | 651 | 54 | 0.0721 | 0.0230 | 0.2778 | 6.9 | 5na6:A, 5na7:A, 5na8:B |
12 | 3x27:D | 314 | 29 | 0.0433 | 0.0287 | 0.3103 | 7.7 | 3x27:A, 3x27:B, 3x27:C |
13 | 7nvo:B | 282 | 38 | 0.0625 | 0.0461 | 0.3421 | 8.4 | 7nvo:b |
14 | 2hnk:B | 232 | 64 | 0.0769 | 0.0690 | 0.2500 | 9.2 | 2hnk:A, 2hnk:C |
15 | 4ifu:A | 330 | 88 | 0.1202 | 0.0758 | 0.2841 | 9.6 | 4ifw:A, 4ifx:A, 4ifz:A, 4ig1:A, 7mgt:A, 4xdr:A, 4xdt:A, 4xdu:A |
16 | 7ttn:E | 528 | 38 | 0.0625 | 0.0246 | 0.3421 | 9.8 | 8i1u:B, 8i1u:J, 7nvl:B, 7nvl:b, 7nvm:B, 7nvm:b, 7nvn:B, 7nvn:b, 8sfe:b, 8sfe:B, 8sff:B, 8sff:b, 8sg8:B, 8sg8:b, 8sg9:B, 8sg9:b, 8sgc:B, 8sgc:b, 8sgl:B, 8sgl:b, 8sgq:B, 8sgq:b, 8sh9:B, 8sh9:b, 8sha:B, 8sha:b, 8shd:B, 8shd:b, 8she:B, 8she:b, 8shf:B, 8shf:b, 8shg:B, 8shg:b, 8shl:B, 8shl:b, 8shn:B, 8shn:b, 8sho:B, 8sho:b, 8shp:B, 8shp:b, 8shq:B, 8shq:b, 8sht:B, 8sht:b, 7trg:E, 7ttt:E, 7tub:E, 7x0s:B, 7x0s:L, 7x0v:B, 7x0v:L, 7x3j:B, 7x3j:b, 7x3u:b, 7x3u:B |