BioLiP

>protein
AVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEED
PAHPRYIQTVWGLGYVFVPDGSKALEHHHH

The query sequence (length=110) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6lxn:A	110	110	1.0000	1.0000	1.0000	2.74e-79	6lxn:B
2	4nhj:A	102	98	0.3091	0.3333	0.3469	3.91e-17	4nhj:B
3	2z33:A	104	96	0.2909	0.3077	0.3333	9.32e-12	1gxp:A, 1gxp:B, 1gxp:E, 1gxp:F
4	6cqg:A	98	74	0.2545	0.2857	0.3784	1.22e-11
5	2gwr:A	225	94	0.2909	0.1422	0.3404	2.79e-11	3nhz:B, 3nhz:C, 3nhz:D
6	2oqr:A	226	66	0.2273	0.1106	0.3788	2.96e-09
7	4kny:B	226	97	0.2545	0.1239	0.2887	1.28e-08	4kfc:A, 4kfc:B, 4kny:A, 1zh2:A, 1zh2:B, 1zh4:A, 1zh4:B
8	4b09:A	218	80	0.2455	0.1239	0.3375	9.00e-08	4b09:B, 4b09:C, 4b09:D, 4b09:E, 4b09:F, 4b09:G, 4b09:I, 4b09:K
9	1ys6:B	227	95	0.2818	0.1366	0.3263	9.76e-08	1ys6:A, 1ys7:A, 1ys7:B
10	8hih:O	217	93	0.2545	0.1290	0.3011	4.03e-07	8hih:P, 8hih:N, 8hih:Q
11	5x5l:E	98	72	0.2000	0.2245	0.3056	1.75e-06	5x5l:B, 5x5l:H, 5x5l:A
12	8b4b:W	110	79	0.2182	0.2182	0.3038	2.46e-05	8b4b:X, 8b4b:Z, 8b4b:Y, 8b4c:D, 8b4d:B, 8b4d:C, 8b4d:D, 8b4e:A, 8b4e:B
13	7lza:A	219	81	0.2273	0.1142	0.3086	0.001	7lz9:A
14	8jo2:H	219	98	0.2273	0.1142	0.2551	0.001	8jo2:I, 4s04:A, 4s04:B, 4s04:E, 4s04:F, 4s05:A, 4s05:B, 3w9s:A, 3w9s:B
15	7e1b:A	209	88	0.2182	0.1148	0.2727	0.031	7e1b:B, 7e1b:C, 7e1b:H, 7e1b:D, 7e1b:E, 7e1b:F, 7e1b:G, 7e1h:A, 7e1h:B, 7e1h:E
16	5ju7:A	107	95	0.2273	0.2336	0.2632	0.50
17	6mvg:A	637	48	0.1182	0.0204	0.2708	0.53	6mvg:B, 6mvg:C
18	4wng:A	330	32	0.1182	0.0394	0.4062	1.3	7ep7:A, 4g2v:A, 3ro2:A, 3ro3:A, 4wnd:A, 4wne:A, 4wnf:A
19	1c9k:B	180	39	0.1273	0.0778	0.3590	1.4	1c9k:A, 1c9k:C
20	3mcm:A	368	49	0.1727	0.0516	0.3878	1.6	3mcn:A
21	4o29:A	207	103	0.2364	0.1256	0.2524	1.9
22	3mco:A	397	49	0.1727	0.0479	0.3878	1.9	3mcn:B, 3mco:B
23	8sl9:A	422	49	0.1727	0.0450	0.3878	2.0	4pzv:A
24	2ptf:A	200	51	0.1545	0.0850	0.3333	3.5	2ptf:B
25	5dll:A	854	47	0.1273	0.0164	0.2979	4.8
26	2icp:A	87	79	0.2091	0.2644	0.2911	5.6
27	6s6z:A	1083	25	0.1091	0.0111	0.4800	6.1	6s6z:D, 6s6z:B, 6s6z:H, 6s6z:F, 6s6z:G, 6s6z:E, 6s6z:C, 6sd0:A, 6sd0:B, 6sd0:C, 6sd0:D
28	4zht:A	384	61	0.1909	0.0547	0.3443	7.8	4zht:B, 4zht:C, 4zht:D
29	6yxx:ED	598	61	0.1636	0.0301	0.2951	8.0	7aoi:XC, 6yxy:ED
30	7msk:A	421	21	0.0727	0.0190	0.3810	9.1	7msk:B

[Back]