BioLiP

>protein
AVDFSAHPWKAPGPNDSRGPCPGLNTLANHGFLPRNGRNISVPMIVKAGFEGYNVQSDILILAGKIGMLTSREADTISLE
DLKLHGTIEHDASLSREDVAIGDNLHFNEAIFTTLANSNPGADVYNISSAAQVQHDRLADSLARNPNVTNTDLTATIRSS
ESAFFLTVMSAGDPLRGEAPKKFVNVFFREERMPIKEGWKRSTTPITIPLLGPIIERITELSDWKPTGDNCGAIVLSPE

The query sequence (length=239) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7zbp:A	239	239	1.0000	1.0000	1.0000	4.49e-179	5fuj:A, 5fuj:B, 5fuk:A, 5fuk:B, 7zbp:B, 7zbp:C, 7zbp:D
2	7znw:C	235	237	0.7490	0.7617	0.7553	8.42e-131	7znm:A, 7znm:B, 7znv:A, 7znw:A
3	7o2d:A	228	212	0.3305	0.3465	0.3726	2.03e-38	7o1r:A, 7o1x:A, 7o1z:A, 7o2g:A
4	7zcl:B	227	204	0.2845	0.2996	0.3333	6.37e-37	7zcl:A
5	8iag:B	223	217	0.3305	0.3543	0.3641	2.26e-35	8iag:A
6	5oxt:A	327	255	0.3473	0.2538	0.3255	1.99e-31	8av5:A, 6ekw:A, 6ekx:A, 6eky:A, 6ekz:A, 6el0:A, 6el4:A, 5oxt:B, 5oxt:C, 5oxu:A, 5oy1:A, 5oy2:A, 7pn4:A, 7pn5:A, 7pn6:A, 7pn7:A, 7pn8:A, 7pn9:A, 7pna:A, 2yor:B, 2yor:A, 2yp1:A, 2yp1:B, 2yp1:C, 2yp1:D
7	2civ:A	299	214	0.2469	0.1973	0.2757	5.26e-15	2ciw:A, 2cix:A, 2ciy:A, 2ciz:A, 2cj0:A, 2cj1:A, 2cj2:A, 1cpo:A, 2cpo:A, 2j18:A, 2j19:A, 2j5m:A, 7rst:A
8	9ceu:P	607	86	0.1046	0.0412	0.2907	3.0	9cev:P, 9cew:P, 9cex:P, 9cey:P, 9cez:P, 8gkh:P
9	8cpl:C	499	51	0.0711	0.0341	0.3333	3.1	8cpl:A, 8cpl:B, 8cpl:D, 1lp1:B, 4uox:A, 4uox:B, 4uox:C, 4uox:D, 4uoy:A, 4uoy:B, 4uoy:C, 4uoy:D
10	5c2v:C	314	70	0.0879	0.0669	0.3000	4.4	5c2v:F, 5c2w:C, 5c2w:F
11	6yyi:B	502	53	0.0586	0.0279	0.2642	7.3
12	8rd8:Kd	144	100	0.1046	0.1736	0.2500	8.2	8rdv:Kd, 8rdw:Kd

[Back]