ATYSYTHSVTYVTDNILKSLKDIILLSGLDPEHFADRWESNTRAIKTWLGTGDLRKVILEIYNPATDKLVTRWDIDIVYG
WSDGDGSFWTDTEQLKYAIKKAGLLPSQAKYKLMLDTKPGRPDVEGWSKGSYRSTDGMVKQSLGSTVEHSGLAGQAGYWR
QR
The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6p8u:B | 165 | 162 | 1.0000 | 0.9818 | 1.0000 | 7.97e-118 | 6p8s:A, 6p8s:B |
2 | 4pdy:A | 332 | 42 | 0.0741 | 0.0361 | 0.2857 | 0.045 | |
3 | 8i9w:CL | 397 | 60 | 0.0802 | 0.0327 | 0.2167 | 0.51 | 8i9t:CL, 8i9v:CL, 8i9x:CL, 8i9y:CL, 8i9z:CL, 8ia0:CL, 8pv1:CL, 8pv2:CL, 8pv3:CL, 8pv4:CL, 8pv5:CL, 8pv6:CL, 8pv7:CL, 8pv8:CL, 8pvk:CL, 8pvl:CL |
4 | 7wx5:A | 288 | 57 | 0.0988 | 0.0556 | 0.2807 | 2.2 | 7wx6:A, 7wx7:A |
5 | 6ncf:B | 676 | 41 | 0.0556 | 0.0133 | 0.2195 | 2.4 | 6ncf:A, 6ncf:C, 6ncf:D, 3o8y:A, 3o8y:B, 7ttk:A, 7ttk:B, 7ttl:A, 7ttl:D, 3v92:B, 3v92:A, 3v98:A, 3v98:B |
6 | 8ebs:J | 149 | 61 | 0.0988 | 0.1074 | 0.2623 | 2.5 | 2a4j:A, 8ebt:J, 8ebv:J, 8ebw:J, 8ebx:J, 2ggm:A, 2ggm:B, 2k2i:A, 2obh:A, 2obh:B |
7 | 7ttj:A | 643 | 41 | 0.0556 | 0.0140 | 0.2195 | 2.5 | 7ttl:B, 3v99:A |
8 | 3qrx:A | 145 | 44 | 0.0802 | 0.0897 | 0.2955 | 2.8 | 1oqp:A |
9 | 5d43:A | 150 | 44 | 0.0741 | 0.0800 | 0.2727 | 3.1 | 5d43:B |
10 | 3kf9:A | 149 | 44 | 0.0802 | 0.0872 | 0.2955 | 4.0 | 3kf9:C |