ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPK
HSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jbr:A | 149 | 149 | 1.0000 | 1.0000 | 1.0000 | 6.46e-112 | 1jbr:B, 1jbs:A, 1jbs:B, 1jbt:A, 1jbt:B |
2 | 3agn:A | 114 | 42 | 0.1141 | 0.1491 | 0.4048 | 0.72 | 3ago:A, 3ahw:A, 1rtu:A |
3 | 3mhs:A | 455 | 58 | 0.1141 | 0.0374 | 0.2931 | 2.5 | 6aqr:A, 4fip:A, 4fip:E, 4fjc:A, 4fk5:A, 6t9l:K, 4w4u:A, 4wa6:A, 4zux:U, 4zux:Z, 4zux:e, 4zux:j |
4 | 5nkn:A | 172 | 69 | 0.1275 | 0.1105 | 0.2754 | 5.8 | 6z6z:A |
5 | 6xa3:A | 409 | 40 | 0.0671 | 0.0244 | 0.2500 | 6.3 | 6xa2:A, 6xa2:B, 6xa2:C, 6xa2:D, 6xa2:E, 6xa2:F, 6xa2:G, 6xa2:H |
6 | 7ttp:A | 345 | 53 | 0.1275 | 0.0551 | 0.3585 | 9.2 |