ATTLNLSYNGPPDTDKNAVHLFASNLKRLVEEKTDGDIQLKLYPNSMLGEEQERMEQVINTPSLNIASFAGLSPIVPEIY
VSAIPFLFEDYEAAHQFFDEGDYWNKVEDTLEERTGAELLGVIEEGGFLDFTNSKRPISSPEDFEGLRFRAMDPSQVALY
EAFGASGTPIPWTDTYMALKTNVADGQMNPPMYIIMGSLYEVQKYLTLANVQYSDQFLIANGEWYDDLSEENRQAIEAAV
QEASELNREDVEKRVDERIQFLADQGMEVIEPTEDELAAFREKGQPAYIEWLTDEQGIDRAWIEMALEDAGQSDLLANAE
NLYFQ
The query sequence (length=325) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4n8g:A | 325 | 325 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4n8g:B, 4n8g:C, 4n8g:D |
2 | 4ngu:A | 317 | 314 | 0.5631 | 0.5773 | 0.5828 | 8.82e-139 | |
3 | 4pdd:A | 303 | 291 | 0.3015 | 0.3234 | 0.3368 | 8.07e-38 | 4pdd:B, 4pdd:C |
4 | 7bbr:A | 310 | 268 | 0.2492 | 0.2613 | 0.3022 | 2.44e-36 | 7bcn:A, 7bco:A, 7bco:B, 7bcp:A, 7bcr:A |
5 | 3gyy:D | 311 | 289 | 0.2892 | 0.3023 | 0.3253 | 6.84e-35 | 3gyy:A, 3gyy:B, 3gyy:C, 2vpn:A, 2vpn:B, 2vpo:A, 2vpo:B |
6 | 4mag:A | 307 | 294 | 0.2708 | 0.2866 | 0.2993 | 7.26e-35 | 7a5q:A, 7a5q:B |
7 | 4oan:A | 312 | 288 | 0.2677 | 0.2788 | 0.3021 | 2.49e-34 | 4oan:B |
8 | 4xeq:B | 304 | 289 | 0.2800 | 0.2993 | 0.3149 | 4.79e-34 | 4xeq:A, 4xeq:C, 4xeq:D |
9 | 4pdh:A | 301 | 283 | 0.2677 | 0.2890 | 0.3074 | 5.47e-34 | |
10 | 4pak:A | 304 | 244 | 0.2400 | 0.2566 | 0.3197 | 6.75e-34 | 4p9k:A |
11 | 3b50:A | 310 | 292 | 0.2492 | 0.2613 | 0.2774 | 4.59e-33 | 2cex:A, 2cex:B, 2cex:C, 2cex:D, 2cey:A, 8cp7:A, 6h75:A, 6h76:A, 2v4c:A, 2wx9:A, 2wyk:A, 2wyp:A, 2xa5:A, 2xwi:A, 2xwk:A, 2xwo:A, 2xwv:A, 2xxk:A |
12 | 3fxb:A | 310 | 271 | 0.2585 | 0.2710 | 0.3100 | 6.36e-31 | 3fxb:B |
13 | 4p3l:A | 303 | 273 | 0.2615 | 0.2805 | 0.3114 | 1.54e-29 | 4p1l:A, 4p1l:B |
14 | 4mmp:A | 308 | 297 | 0.2523 | 0.2662 | 0.2761 | 3.24e-29 | |
15 | 4pf8:A | 300 | 266 | 0.2400 | 0.2600 | 0.2932 | 1.16e-28 | 4pf8:B |
16 | 4x8r:A | 304 | 271 | 0.2615 | 0.2796 | 0.3137 | 7.70e-28 | 4x8r:B |
17 | 4nq8:B | 301 | 299 | 0.2708 | 0.2924 | 0.2943 | 1.87e-27 | 4nq8:A |
18 | 4mnp:A | 305 | 293 | 0.2554 | 0.2721 | 0.2833 | 1.91e-27 | |
19 | 7t3e:A | 300 | 262 | 0.2277 | 0.2467 | 0.2824 | 1.32e-26 | 7t3e:B |
20 | 4p8b:A | 314 | 272 | 0.2369 | 0.2452 | 0.2831 | 5.43e-25 | |
21 | 8te9:B | 309 | 296 | 0.2462 | 0.2589 | 0.2703 | 9.28e-25 | 8te9:A |
22 | 4n91:A | 308 | 274 | 0.2277 | 0.2403 | 0.2701 | 1.52e-23 | |
23 | 4o8m:A | 303 | 273 | 0.2277 | 0.2442 | 0.2711 | 6.00e-23 | 4o8m:B, 4o8m:C, 4o8m:D, 4o8m:E, 4o8m:F, 4o8m:G, 4o8m:H |
24 | 4xfe:A | 306 | 307 | 0.2369 | 0.2516 | 0.2508 | 3.71e-21 | |
25 | 4x04:A | 301 | 279 | 0.2215 | 0.2392 | 0.2581 | 1.02e-20 | 4x04:B, 4x04:C, 4x04:D |
26 | 4ovt:A | 301 | 293 | 0.2215 | 0.2392 | 0.2457 | 5.85e-20 | 4ovt:B |
27 | 4ovq:A | 302 | 254 | 0.2215 | 0.2384 | 0.2835 | 1.67e-19 | |
28 | 4nx1:A | 308 | 296 | 0.2554 | 0.2695 | 0.2804 | 2.74e-19 | 4nx1:B, 4ovp:A, 4ovp:B |
29 | 4pc9:A | 300 | 260 | 0.2154 | 0.2333 | 0.2692 | 3.66e-19 | 4pcd:A |
30 | 4pbq:A | 304 | 272 | 0.2369 | 0.2533 | 0.2831 | 4.83e-19 | 4pbq:B, 4pbq:C |
31 | 4mij:A | 302 | 276 | 0.2185 | 0.2351 | 0.2572 | 3.66e-18 | 4mhf:A |
32 | 4nhb:B | 311 | 323 | 0.2646 | 0.2765 | 0.2663 | 4.00e-18 | 4nhb:A |
33 | 4n8y:A | 300 | 276 | 0.1938 | 0.2100 | 0.2283 | 1.72e-17 | 4n8y:B |
34 | 4n15:A | 301 | 281 | 0.2338 | 0.2525 | 0.2705 | 4.18e-17 | 4n17:A |
35 | 4ovr:A | 298 | 284 | 0.2308 | 0.2517 | 0.2641 | 1.28e-15 | 4ovr:B |
36 | 4pfb:A | 308 | 278 | 0.2246 | 0.2370 | 0.2626 | 1.47e-14 | |
37 | 7nra:BBB | 328 | 303 | 0.2277 | 0.2256 | 0.2442 | 3.55e-11 | 7nra:AAA |
38 | 4n6k:A | 311 | 161 | 0.1385 | 0.1447 | 0.2795 | 4.69e-10 | |
39 | 2pfy:A | 301 | 288 | 0.2031 | 0.2193 | 0.2292 | 9.80e-10 | 2pfy:B, 2pfy:C, 2pfy:D |
40 | 4p56:B | 317 | 283 | 0.1938 | 0.1987 | 0.2226 | 2.18e-09 | 4p56:A, 4p56:C |
41 | 2zzv:A | 330 | 173 | 0.1446 | 0.1424 | 0.2717 | 7.94e-08 | 2zzv:B, 2zzw:A, 2zzw:B, 2zzx:C |
42 | 2pfz:A | 301 | 282 | 0.1969 | 0.2126 | 0.2270 | 8.80e-08 | |
43 | 7nqg:AAA | 317 | 290 | 0.1938 | 0.1987 | 0.2172 | 5.66e-07 | |
44 | 5i7i:B | 320 | 320 | 0.2277 | 0.2313 | 0.2313 | 1.34e-06 | 5i7i:A, 5izz:A |
45 | 4pai:A | 308 | 214 | 0.1785 | 0.1883 | 0.2710 | 7.67e-06 | |
46 | 7nrr:AAA | 329 | 291 | 0.2308 | 0.2280 | 0.2577 | 6.73e-04 | 7nrr:BBB, 7nsw:AAA, 7nsw:BBB, 7ntd:AAA, 7ntd:BBB, 7nte:A, 7nte:B |
47 | 4pe3:A | 315 | 174 | 0.1292 | 0.1333 | 0.2414 | 0.003 | |
48 | 7e9y:A | 563 | 67 | 0.0677 | 0.0391 | 0.3284 | 0.007 | |
49 | 4xf5:A | 317 | 53 | 0.0585 | 0.0599 | 0.3585 | 0.13 | 4uab:A, 4uab:B, 4xf5:B |
50 | 4pet:A | 329 | 189 | 0.1354 | 0.1337 | 0.2328 | 0.98 | 4pet:B |
51 | 3bqk:A | 338 | 121 | 0.0923 | 0.0888 | 0.2479 | 1.6 | 3bql:A |
52 | 5c16:A | 487 | 89 | 0.0677 | 0.0452 | 0.2472 | 1.7 | 5c16:B, 5c16:C, 5c16:D |
53 | 5yko:A | 487 | 108 | 0.0892 | 0.0595 | 0.2685 | 1.9 | 5ykn:A |
54 | 6bs3:B | 355 | 35 | 0.0369 | 0.0338 | 0.3429 | 3.1 | 6bs4:B |
55 | 1o9j:A | 494 | 52 | 0.0492 | 0.0324 | 0.3077 | 3.9 | 1o9j:B, 1o9j:C, 1o9j:D |
56 | 4mnc:A | 305 | 212 | 0.1754 | 0.1869 | 0.2689 | 4.0 | 4mni:A |
57 | 5eom:J | 286 | 67 | 0.0554 | 0.0629 | 0.2687 | 4.3 | |
58 | 1nyq:B | 645 | 46 | 0.0554 | 0.0279 | 0.3913 | 4.4 | 1nyq:A, 1nyr:A, 1nyr:B |
59 | 5w3p:H | 215 | 60 | 0.0492 | 0.0744 | 0.2667 | 4.9 | |
60 | 2d73:A | 717 | 63 | 0.0369 | 0.0167 | 0.1905 | 6.7 | 2d73:B, 2jka:A, 2jka:B, 2jke:A, 2jke:B, 2jkp:A, 2jkp:B, 3wfa:A, 3wfa:B, 2zq0:A, 2zq0:B |
61 | 3nyn:A | 553 | 55 | 0.0431 | 0.0253 | 0.2545 | 7.2 | 2acx:A, 2acx:B, 3nyn:B, 3nyo:A, 3nyo:B |
62 | 7roq:A | 1831 | 57 | 0.0462 | 0.0082 | 0.2632 | 8.2 | |
63 | 7cyy:C | 497 | 127 | 0.0954 | 0.0624 | 0.2441 | 8.7 | 7cx7:A, 7cx7:B, 7cx7:C, 7cx7:D, 7cx7:E, 7cx7:F, 7cyy:A, 7cyy:B, 7cyy:D, 7cyy:E, 7cyy:F |
64 | 5x71:A | 796 | 65 | 0.0646 | 0.0264 | 0.3231 | 9.8 | 5x6y:A, 5x6y:C, 5x6z:C, 5x6z:A, 5x6z:D, 5x6z:B, 5x70:A, 5x70:B, 5x71:B |