BioLiP

>protein
ATSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESL
TYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMD
DTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNAVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQAR
YFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT

The query sequence (length=296) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3w0s:A	298	296	0.9797	0.9732	0.9797	0.0	3tyk:A, 3w0n:A, 3w0o:A, 3w0p:A, 3w0q:A, 3w0r:A
2	5igi:A	300	84	0.0912	0.0900	0.3214	0.003	5igj:A, 5igp:A, 5igr:A, 5igs:A, 5igt:A
3	3ham:A	299	218	0.1520	0.1505	0.2064	0.006	4dca:A, 3ham:B, 3hav:A, 3hav:B, 3hav:C, 3uzr:A
4	7f0b:A	282	43	0.0574	0.0603	0.3953	0.027	7f0c:A, 7f0f:A
5	8i85:A	280	43	0.0608	0.0643	0.4186	0.048	8i82:A, 8i84:A, 8i86:A, 8i89:A, 8i8g:A, 8i8h:A
6	5uxd:A	300	32	0.0473	0.0467	0.4375	0.13	5uxc:A, 5uxd:B
7	3dxp:A	329	226	0.1655	0.1489	0.2168	0.36
8	7w15:A	294	54	0.0642	0.0646	0.3519	0.38	7w15:B, 7w19:A, 7w19:B, 7w1a:B, 7w1a:A
9	3f69:B	283	94	0.0912	0.0954	0.2872	0.96	6b2p:A, 3f61:A, 3f69:A, 2fum:A, 2fum:B, 2fum:C, 2fum:D, 6i2p:A, 6i2p:B, 1mru:A, 1mru:B, 1o6y:A, 3ori:A, 3ori:B, 3ori:C, 3ori:D, 3ork:A, 3orl:A, 3orm:A, 3oro:A, 3orp:A, 3ort:A, 5u94:A
10	6a5n:A	502	53	0.0608	0.0359	0.3396	0.96
11	1y9g:A	517	64	0.0709	0.0406	0.3281	1.4
12	3tdw:A	302	207	0.1351	0.1325	0.1932	1.5	6ctz:A, 3tdv:A, 3tdv:B
13	4dfb:B	301	34	0.0439	0.0432	0.3824	1.6	5c4k:A, 5c4l:A, 5c4l:B, 6cd7:B, 4dfb:A, 4dfu:A, 4dfu:B, 4dt8:A, 4dt8:B, 4dt9:A, 4dt9:B, 4dta:A, 4dta:B, 4dtb:A, 4dtb:B, 4n57:A, 4n57:B, 3sg8:A, 3sg8:B, 3sg9:A, 3sg9:B
14	7ezt:B	727	23	0.0439	0.0179	0.5652	3.7
15	2rcc:C	311	66	0.0676	0.0643	0.3030	3.9	2rcc:B
16	2b0q:A	263	166	0.1182	0.1331	0.2108	6.1	2bkk:A, 2bkk:C, 1j7l:A, 1j7l:B, 1j7u:A, 1j7u:B, 1l8t:A, 3q2j:A, 3q2j:B, 3tm0:A
17	5uxa:A	301	85	0.0676	0.0664	0.2353	6.2	5igv:A, 5igw:A, 5igy:A, 5igz:A, 5ih0:A, 5ih1:A, 5iwu:A
18	3d45:A	383	69	0.0642	0.0496	0.2754	6.3	2a1r:A, 2a1r:B
19	3d45:B	373	69	0.0642	0.0509	0.2754	6.7	3ctr:A
20	7s3l:A	254	52	0.0473	0.0551	0.2692	6.8
21	2vvt:A	269	47	0.0439	0.0483	0.2766	7.7	2jfo:A, 2jfo:B, 2jfp:A, 2jfp:B, 2vvt:B
22	8bx8:C	3947	76	0.0608	0.0046	0.2368	8.1	7k58:C, 7k5b:C, 7kek:C

[Back]