ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCP
VPFCLNIKQK
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xez:A | 163 | 90 | 1.0000 | 0.5521 | 1.0000 | 6.63e-63 | 8e1d:A, 1f81:A, 2mzd:A, 7xfg:A |
2 | 6fgs:A | 130 | 90 | 1.0000 | 0.6923 | 1.0000 | 7.17e-63 | |
3 | 6fgn:A | 124 | 90 | 1.0000 | 0.7258 | 1.0000 | 3.78e-62 | |
4 | 3io2:A | 109 | 87 | 0.9667 | 0.7982 | 1.0000 | 2.49e-60 | 3p57:P |
5 | 3t92:A | 113 | 84 | 0.9333 | 0.7434 | 1.0000 | 3.53e-58 | |
6 | 5hp0:A | 122 | 87 | 0.8778 | 0.6475 | 0.9080 | 2.55e-53 | |
7 | 5hpd:A | 158 | 87 | 0.8778 | 0.5000 | 0.9080 | 3.01e-53 | 2ka6:A, 2kje:A |
8 | 5hou:A | 171 | 61 | 0.2444 | 0.1287 | 0.3607 | 0.027 | 2ka4:A, 1l3e:B, 1l8c:A, 7lvs:B, 2lww:A, 1p4q:B, 7qgs:A, 1r8u:B, 1u2n:A |
9 | 8j43:A | 285 | 49 | 0.1778 | 0.0561 | 0.3265 | 0.89 | 8j43:B |
10 | 1ea0:A | 1452 | 31 | 0.1222 | 0.0076 | 0.3548 | 1.6 | 1ea0:B |
11 | 6s6t:A | 1472 | 31 | 0.1222 | 0.0075 | 0.3548 | 1.6 | 6s6s:A, 6s6s:B, 6s6s:C, 6s6s:D, 6s6t:B, 6s6t:C, 6s6t:D, 6s6u:A, 6s6u:B, 6s6u:C, 6s6u:D, 6s6u:E, 6s6u:F, 6s6x:A, 6s6x:B, 6s6x:C, 6s6x:D, 6s6x:E, 6s6x:F, 2vdc:A, 2vdc:B, 2vdc:C, 2vdc:D, 2vdc:E, 2vdc:F |
12 | 3ntl:A | 388 | 52 | 0.2222 | 0.0515 | 0.3846 | 2.9 | 3ntl:B |
13 | 7t3u:A | 2020 | 47 | 0.1444 | 0.0064 | 0.2766 | 6.0 | 7t3u:D |
14 | 2fq1:A | 279 | 34 | 0.1111 | 0.0358 | 0.2941 | 6.3 | |
15 | 8s91:A | 602 | 28 | 0.1000 | 0.0150 | 0.3214 | 6.7 | 7dp3:A, 8s91:B, 8s91:C, 8s94:A, 8s94:C, 8s94:B |
16 | 7wi7:A | 565 | 28 | 0.1000 | 0.0159 | 0.3214 | 7.1 | |
17 | 8cvc:A | 327 | 63 | 0.2111 | 0.0581 | 0.3016 | 7.5 | 8cv8:A, 8cv9:A, 8cva:A, 8cvb:A, 8cvd:A, 8cve:A, 8cvf:A, 8cvg:A, 8cvh:A |
18 | 7zol:B | 1702 | 32 | 0.1444 | 0.0076 | 0.4062 | 9.8 | 7zoq:B |