ASYSIGDLVFAKVKGYPPWPAKITKSNKKYNVYFYGTGETANIKLEDLFPYASNKERFATEKIMKRAKFIEAIDQIESAL
The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6kcp:B | 84 | 82 | 1.0000 | 0.9524 | 0.9756 | 1.52e-52 | 6kco:O, 6kco:F, 6kco:M, 6kco:E, 6kco:P, 6kco:B, 6kco:H, 6kco:D, 6kco:I, 6kco:N, 6kco:G, 6kco:J, 6kco:L, 6kco:A, 6kco:C, 6kco:K |
2 | 5xsk:A | 90 | 84 | 0.5000 | 0.4444 | 0.4762 | 8.61e-19 | |
3 | 6iit:B | 100 | 84 | 0.4750 | 0.3800 | 0.4524 | 2.94e-16 | 6iiq:A, 6iiq:B, 6iir:A, 6iir:B, 6iis:B, 6iis:A, 6iit:A |
4 | 8cbn:L | 86 | 80 | 0.4125 | 0.3837 | 0.4125 | 4.48e-16 | 8cbn:K, 8cbq:K, 8pc5:K, 8pc6:L, 8pc6:K, 8peo:K, 8pep:L, 8pep:K, 6s01:K |
5 | 3qj6:A | 90 | 83 | 0.4375 | 0.3889 | 0.4217 | 2.52e-15 | 3qby:B |
6 | 9exw:A | 148 | 49 | 0.2250 | 0.1216 | 0.3673 | 1.44e-05 | 9exw:B, 9exx:A, 9exx:B, 9exy:A, 7lmt:A, 7lmt:H, 7lmt:B, 7lmt:C, 7lmt:D, 7lmt:E, 7lmt:F, 7lmt:G, 7mdn:A, 7mdn:H, 7mdn:B, 7mdn:C, 7mdn:D, 7mdn:E, 7mdn:F, 7mdn:G, 6ue6:A, 6ue6:B, 6ue6:D, 6ue6:E, 6ue6:G, 6ue6:H, 5vc8:A, 7vln:B, 6xcg:A, 6xcg:B, 6xcg:C |
7 | 9exy:B | 135 | 96 | 0.3750 | 0.2222 | 0.3125 | 2.76e-05 | 6ue6:C, 6ue6:F |
8 | 4n4g:A | 209 | 73 | 0.3000 | 0.1148 | 0.3288 | 0.001 | 4n4h:A, 4n4i:A, 4ns5:A |
9 | 6g2b:A | 123 | 68 | 0.2250 | 0.1463 | 0.2647 | 0.008 | 6g24:A, 6g25:A, 6g27:A, 6g29:A, 6g2c:A, 6g2e:A, 6g2f:A, 6g2o:A |
10 | 5ciu:B | 121 | 65 | 0.2250 | 0.1488 | 0.2769 | 0.009 | |
11 | 5nrr:B | 137 | 65 | 0.2250 | 0.1314 | 0.2769 | 0.013 | 5ciu:A, 5nr3:A, 5nr3:B, 5nrr:A, 5nrs:A, 5nrs:B, 5nrv:D, 5nrv:A, 5nv0:A, 5nv0:B, 5nv2:A, 5nv2:B, 5nv7:A, 5nv7:B, 6r3e:A |
12 | 5b73:A | 313 | 71 | 0.2500 | 0.0639 | 0.2817 | 0.017 | 4cos:A, 7cwh:B, 5y1z:C, 5y1z:D |
13 | 3mo8:A | 127 | 29 | 0.1500 | 0.0945 | 0.4138 | 0.81 | 5c6s:A, 2x4w:A, 2x4x:A, 2x4x:C, 2x4x:E, 2x4x:G, 2x4y:A, 2x4y:C, 2x4y:E, 2x4y:G, 2x4y:I, 2x4y:K, 2x4y:M, 2x4y:O |
14 | 6j3f:A | 254 | 52 | 0.2500 | 0.0787 | 0.3846 | 5.8 | 6j3f:B |
15 | 6fwf:A | 712 | 19 | 0.1125 | 0.0126 | 0.4737 | 7.5 | |
16 | 4mc5:C | 497 | 36 | 0.1625 | 0.0262 | 0.3611 | 8.5 | 8gv7:A, 4k3x:B, 4k3x:D, 4k3x:F, 4mc5:A, 4mc5:B, 7wvg:A |