Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4a4f:A 64 64 1.0000 1.0000 1.0000 2.83e-43 4a4h:A, 8poi:A
2 4a4e:A 64 52 0.4062 0.4062 0.5000 1.52e-12 4a4g:A, 4qq6:A, 7w2p:A, 7w30:A, 7w30:B, 7w30:C, 7w30:D
3 5yj8:A 60 53 0.3594 0.3833 0.4340 1.33e-11 8jtn:A, 2lto:A, 6v9t:AAA, 6v9t:BBB
4 5m9n:A 202 51 0.2812 0.0891 0.3529 4.17e-04 5m9n:B
5 7cfd:F 182 53 0.3281 0.1154 0.3962 0.001 7cfd:B, 7cfd:A, 7cfd:C, 7cfd:E, 7cfd:G, 7cfd:H, 7cfd:D
6 4b9w:A 196 52 0.2812 0.0918 0.3462 0.018 4b9w:B
7 3nth:A 167 54 0.2656 0.1018 0.3148 0.11 3nti:A
8 7pub:CJ 803 57 0.2812 0.0224 0.3158 1.8 6hiv:CJ, 6hiw:CJ, 6hiz:CJ, 7pua:CJ
9 6g1o:A 486 20 0.1875 0.0247 0.6000 2.2
10 5vqh:A 213 46 0.2188 0.0657 0.3043 3.5 5vqh:B
11 5h2d:A 418 49 0.2656 0.0407 0.3469 3.6 5wvr:A
12 7aor:e 810 35 0.1562 0.0123 0.2857 4.7
13 6ms8:G 209 29 0.1562 0.0478 0.3448 8.1 6ms8:A, 6ms8:D, 6ms8:E, 6ms8:F
14 7wu4:R 286 20 0.1406 0.0315 0.4500 8.2 7wu3:R, 7wu5:R
15 3nzi:A 211 32 0.1719 0.0521 0.3438 8.9 8se7:Q

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417