ASTGEIAKAKLDEFLIYHKTDAKLKPFIYRPKNAQILLTKDIRDPKTREPLQPRPPVKPLSKQTLNDFIYSVEPNSTELL
DWFKEWTGTSIRKRAIWTYISPIHVQKMLTASFFKIGKYAHMVGLLYGIEHKFLKAQNPSVFDIEHFFNTNIMCALHRNR
LKDYKDAEIAQRKLQVAWKKVLNRKNNTGLANILVATLGRQIGFTPELTGLQPVDISLPDIPNSSSGAELKDLLSKYEGI
YLIARTLLDIDQHNAQYLELQEFIRQYQNALSESSDPYDTHLKALGLLETP
The query sequence (length=291) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8om2:5 | 291 | 291 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8d8j:5, 8d8k:5, 8d8l:5, 8om3:5, 8om4:5 |
2 | 5mrc:55 | 59 | 95 | 0.2027 | 1.0000 | 0.6211 | 2.34e-29 | 5mre:55, 5mrf:55 |
3 | 5cq9:B | 270 | 113 | 0.1100 | 0.1185 | 0.2832 | 2.0 | |
4 | 6jsj:A | 625 | 40 | 0.0378 | 0.0176 | 0.2750 | 2.9 | 6jsj:B, 6jsj:C |
5 | 1itw:A | 740 | 136 | 0.1065 | 0.0419 | 0.2279 | 3.0 | 1itw:B, 1itw:C, 1itw:D, 1j1w:A, 1j1w:B, 1j1w:C, 1j1w:D |
6 | 6ey7:B | 227 | 48 | 0.0481 | 0.0617 | 0.2917 | 4.8 | 6ey7:A, 6ey7:C, 6ey7:D, 3n4p:A, 3n4p:B, 3n4p:C, 3n4p:D, 3n4q:A, 3n4q:B, 3n4q:C, 3n4q:D |
7 | 7yi2:D | 321 | 77 | 0.0687 | 0.0623 | 0.2597 | 6.6 | 7yi0:D, 7yi3:D, 7yi4:D, 7yi5:D |
8 | 5w7g:A | 131 | 33 | 0.0515 | 0.1145 | 0.4545 | 7.0 | 5w7g:C, 5w7g:E, 5w7g:G, 5w7g:I, 5w7g:K, 5w7g:M, 5w7g:O, 5w7g:Q, 5w7g:S, 5w7g:U, 5w7g:W, 5w7g:Y, 5w7g:a, 5w7g:c, 5w7g:e, 5w7g:g, 5w7g:i, 5w7g:k, 5w7g:m, 5w7g:o |
9 | 7yi0:F | 120 | 47 | 0.0447 | 0.1083 | 0.2766 | 8.5 |