BioLiP

>protein
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIE
GQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML

The query sequence (length=112) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1eqq:B	120	112	1.0000	0.9333	1.0000	1.17e-79	1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D
2	6irq:C	104	110	0.7143	0.7692	0.7273	1.32e-53	6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D
3	5odn:D	106	100	0.4911	0.5189	0.5500	7.43e-35	5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H
4	5odp:G	100	84	0.4286	0.4800	0.5714	4.93e-30	5odp:A
5	3ulp:C	116	102	0.3571	0.3448	0.3922	3.51e-29	3ulp:A, 3ulp:B, 3ulp:D
6	2vw9:A	108	90	0.3661	0.3796	0.4556	9.83e-22	2vw9:B
7	6bhx:C	102	100	0.3482	0.3824	0.3900	1.28e-19	6bhx:A, 6bhx:B
8	6rup:A	111	103	0.3214	0.3243	0.3495	9.70e-19	6rup:B, 8uzt:A, 8uzt:C, 8uzt:D
9	3a5u:A	118	102	0.3393	0.3220	0.3725	3.49e-16	3a5u:B
10	8gw5:A	99	100	0.3036	0.3434	0.3400	7.03e-16	7ym1:A
11	7dep:B	102	100	0.3482	0.3824	0.3900	1.05e-15
12	8uzt:B	100	82	0.2857	0.3200	0.3902	2.20e-15
13	3vdy:A	101	99	0.3304	0.3663	0.3737	1.17e-14	3vdy:B
14	3udg:C	214	82	0.2857	0.1495	0.3902	2.25e-11	3udg:B, 3udg:A
15	3udg:C	214	100	0.3482	0.1822	0.3900	3.40e-11	3udg:B, 3udg:A
16	8t2s:D	389	41	0.1429	0.0411	0.3902	0.94	8t2r:D, 8t2t:D, 7uim:D, 7uin:D
17	1jju:B	337	46	0.1607	0.0534	0.3913	1.0	1pby:B
18	6ktv:A	431	48	0.1161	0.0302	0.2708	9.3	6h98:A, 6h99:A, 6h9a:A, 6ktw:A, 6ktx:A, 6ktz:A, 6ku1:A, 6ku1:B, 6ku2:A, 6ku2:E, 6kvw:A, 6kvw:B, 6kvy:A, 6kvz:A, 6kw0:A, 6kw0:B
19	7y5g:B	302	58	0.1071	0.0397	0.2069	10.0	7y5g:A, 7y5h:B, 7y5h:A

[Back]