ARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGL
TEKDFALAKFMDDAAKNFE
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2v6t:B | 100 | 99 | 1.0000 | 0.9900 | 1.0000 | 6.56e-71 | 2v6t:A |
2 | 1f93:A | 103 | 94 | 0.4545 | 0.4369 | 0.4787 | 1.77e-27 | 1dcp:A, 1dcp:B, 1dcp:C, 1dcp:D, 1dcp:E, 1dcp:F, 1dcp:G, 1dcp:H, 1f93:B, 1f93:C, 1f93:D |
3 | 7pkq:s | 87 | 41 | 0.1212 | 0.1379 | 0.2927 | 0.13 | |
4 | 8q3b:A | 1423 | 60 | 0.1818 | 0.0126 | 0.3000 | 0.16 | 8q3k:A |
5 | 8iib:A | 355 | 45 | 0.1313 | 0.0366 | 0.2889 | 1.4 | 8iib:B |
6 | 3ty3:A | 358 | 64 | 0.2121 | 0.0587 | 0.3281 | 2.6 | 3ty3:B |
7 | 7aor:d | 445 | 38 | 0.1414 | 0.0315 | 0.3684 | 2.9 | |
8 | 4ihq:A | 512 | 27 | 0.1111 | 0.0215 | 0.4074 | 6.4 | 4ihq:B, 4ihq:C |
9 | 7ane:d | 343 | 38 | 0.1313 | 0.0379 | 0.3421 | 9.0 |