ARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA
The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4bnr:J | 58 | 43 | 1.0000 | 0.7414 | 1.0000 | 2.34e-26 | 1bhc:J, 4bnr:I, 1bpi:A, 1bz5:A, 2fi3:I, 2fi4:I, 2fi5:I, 3fp7:J, 2ftl:I, 2ftm:B, 3ldj:B, 3ldj:C, 6pti:A, 1qlq:A |
2 | 5nx1:D | 42 | 41 | 0.4419 | 0.4524 | 0.4634 | 9.27e-09 | 5nx3:D |
3 | 5jbt:Y | 38 | 38 | 0.3721 | 0.4211 | 0.4211 | 3.94e-07 | |
4 | 4bqd:A | 78 | 40 | 0.3721 | 0.2051 | 0.4000 | 5.53e-07 | 4bqd:B |
5 | 2knt:A | 58 | 38 | 0.3023 | 0.2241 | 0.3421 | 6.67e-05 | 1knt:A |
6 | 2pfy:A | 301 | 22 | 0.2093 | 0.0299 | 0.4091 | 1.8 | 2pfy:B, 2pfy:C, 2pfy:D |
7 | 8btd:SC | 210 | 42 | 0.3953 | 0.0810 | 0.4048 | 6.3 | 8br8:SC, 8brm:SC, 8bsi:SC, 8bsj:SC, 8btr:SC, 8fvy:D, 8g4s:D, 7pwf:D, 7pwo:D1 |
8 | 6ffn:A | 182 | 20 | 0.1860 | 0.0440 | 0.4000 | 7.1 | 1cqq:A, 6ffs:A, 5fx5:A, 5fx6:A, 2xya:A |