AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAM
The query sequence (length=188) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2ndo:A |
189 |
188 |
1.0000 |
0.9947 |
1.0000 |
2.72e-141 |
6bqx:A, 6br4:A, 6br4:B, 8cxd:A, 8cxd:B, 8czm:A, 8czm:B, 8czn:A, 8czn:B, 8d10:A, 8d10:B, 8d11:A, 8d11:B, 8d12:A, 8d12:B, 8dg1:B, 8dg2:B, 3dks:B, 3dks:C, 3dks:A, 3dks:D, 8dn0:A, 8dn0:B, 8eoc:B, 8eqo:B, 7l76:A, 7l76:B, 7l7c:A, 7l7c:B, 7lhp:A, 7lhp:B, 7lsm:A, 6pbi:A, 6pc9:A, 6pd7:A, 6pdh:A, 6pg1:A, 6pg1:B, 6pg2:A, 6pg2:B, 6pgj:A, 6pgj:B, 6piq:A, 6piq:B, 6pli:A, 6pli:B, 6pmf:A, 6pmf:B, 6pml:A, 6pml:B, 6poh:A, 6poh:B, 6poi:A, 6poi:B, 6poq:A, 6poq:B, 6pvy:A, 6pvy:B, 6pvz:A, 6pvz:B, 7s1c:A, 7s1c:B, 7s1d:A, 7s1d:B, 7s1f:A, 7s1f:B, 7s1l:A, 7s1l:B, 4tky:B, 4tky:A, 4tky:C, 4tky:D, 7ttv:A, 7ttv:B, 8u1y:A, 8u1y:B, 8u59:A, 8u59:B, 8ubq:A, 8ubq:B, 4wet:A, 4wey:A, 4wf4:B, 4wf5:A, 4wf5:B, 6whd:A, 6whd:B, 6xsp:A, 6xsp:B, 6xsq:A, 6xsq:B, 6xt3:A, 6xt3:B, 4zij:A, 4zij:B |
2 |
4od7:A |
187 |
185 |
0.5585 |
0.5615 |
0.5676 |
9.48e-78 |
4od7:C, 4od7:B |
3 |
7lui:A |
180 |
185 |
0.3777 |
0.3944 |
0.3838 |
4.03e-43 |
|
4 |
5tlq:A |
190 |
165 |
0.2713 |
0.2684 |
0.3091 |
1.85e-19 |
5dch:A, 4zl8:A |
5 |
7luh:A |
191 |
186 |
0.2872 |
0.2827 |
0.2903 |
4.83e-15 |
7luj:A, 7luj:B, 7luj:C, 7luj:D, 5vyo:A, 5vyo:B, 5vyo:C, 5vyo:D |
6 |
2rem:C |
191 |
162 |
0.2021 |
0.1990 |
0.2346 |
3.16e-08 |
|
7 |
3feu:A |
183 |
197 |
0.2660 |
0.2732 |
0.2538 |
0.024 |
|
8 |
7tmm:B |
464 |
62 |
0.1117 |
0.0453 |
0.3387 |
1.2 |
7tmo:B, 7tmp:B |
9 |
8w2h:A |
761 |
87 |
0.1223 |
0.0302 |
0.2644 |
1.9 |
7lw1:A, 7lw1:D, 7lw1:E, 7lw1:F, 8w2g:A, 8w2g:B, 8w2g:D, 8w2g:C, 8w2h:B, 8w2h:C, 8w2h:D, 8w2j:E, 8w2j:F, 8w2j:G, 8w2j:H, 8w2j:A, 8w2j:B, 8w2j:C, 8w2j:D |
10 |
4z7x:A |
211 |
26 |
0.0585 |
0.0521 |
0.4231 |
2.7 |
4z7x:B |
11 |
3idv:A |
235 |
31 |
0.0691 |
0.0553 |
0.4194 |
7.2 |
|