BioLiP

>protein
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYE

The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1be3:J	62	59	1.0000	0.9516	1.0000	2.33e-39	1bgy:J, 1bgy:V, 7dkf:J1, 7dkf:V1, 5luf:j, 5luf:v, 5nmi:W, 5nmi:J, 1sqp:J, 2ybb:j, 2ybb:J
2	5xte:D	62	59	0.8814	0.8387	0.8814	8.64e-36	5xte:Q, 5xth:AD, 5xth:AQ, 5xti:AD, 5xti:AQ
3	8bel:I	57	47	0.3220	0.3333	0.4043	1.59e-06	8bel:S, 8bpx:AI, 8bpx:BI, 8bq5:AI, 8bq5:BI, 8bq6:AI, 8bq6:BI
4	8e73:V	59	47	0.2881	0.2881	0.3617	4.13e-05	8e73:J
5	2cfm:A	561	39	0.2542	0.0267	0.3846	0.37
6	6wbo:A	555	39	0.2712	0.0288	0.4103	0.65
7	8cej:A	449	36	0.1864	0.0245	0.3056	1.4	8cej:B, 8cej:C, 8cej:D, 8cek:A, 8cek:B, 8cek:C, 8cek:D
8	3rbm:B	362	27	0.1864	0.0304	0.4074	2.1	3cc9:A, 3cc9:B, 3cc9:D, 3ez3:A, 3ez3:B, 3ez3:C, 3ez3:D, 5hn7:A, 5hn7:B, 5hn7:C, 5hn7:D, 5hn7:G, 5hn7:E, 5hn7:F, 5hn7:H, 5hn8:C, 5hn9:A, 5hn9:B, 5hn9:D, 5hna:A, 5hna:B, 5hna:C, 5hna:D, 3ldw:A, 3ldw:B, 3ldw:C, 3ldw:D, 3ph7:A, 3ph7:B, 3ph7:D, 3rbm:A, 3rbm:C, 3rbm:D, 3ryw:A, 3ryw:D, 3ryw:B, 3ryw:C
9	5hn8:D	334	27	0.1864	0.0329	0.4074	2.1	3cc9:C, 5hn8:A, 5hn8:B, 5hn9:C, 3ph7:C
10	7rpx:E	590	41	0.2373	0.0237	0.3415	2.7	2hix:A, 7rpo:E, 7rpw:E
11	3cpm:A	184	34	0.2203	0.0707	0.3824	3.2	3m6o:A, 3m6o:B, 3m6p:A, 3m6p:B, 3m6q:A, 3m6r:A, 3m6r:B, 3m6r:C, 3m6r:D, 3o3j:A, 3pn2:A, 3pn3:A, 3pn3:B, 3pn4:A, 3pn5:A, 3pn6:A, 3pn6:B
12	4eq5:A	516	39	0.2373	0.0271	0.3590	7.4
13	1z16:A	344	16	0.1695	0.0291	0.6250	8.2	1z17:A, 1z18:A
14	7vru:B	494	48	0.2373	0.0283	0.2917	8.3	7vs4:B
15	6gaw:Ah	120	22	0.1525	0.0750	0.4091	9.8	6gaz:Ah, 7nql:Ah, 7nsi:Ah, 7nsj:Ah, 6ydp:Ah, 6ydw:Ah

[Back]