BioLiP

>protein
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK

The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5t6j:A	59	59	1.0000	1.0000	1.0000	3.25e-36	4geq:D, 4geq:B
2	7kdf:C	95	56	0.8814	0.5474	0.9286	1.74e-31
3	5i5m:B	576	42	0.2542	0.0260	0.3571	0.90	5i5m:A
4	8tl0:I	479	41	0.1864	0.0230	0.2683	1.3	8tl0:A, 8tl0:D, 8tl0:B, 8tl0:C, 8tl0:L, 8tl0:K
5	2pny:A	233	34	0.2034	0.0515	0.3529	1.4
6	8ro2:C	908	46	0.2542	0.0165	0.3261	2.0	7aav:r, 7abf:r, 7abg:r, 7abi:r, 6ah0:C, 6ahd:C, 8c6j:C, 8ch6:b, 7dvq:C, 6ff4:B, 6ff7:B, 9fmd:C, 8h6e:5C, 8h6j:5C, 8h6k:5C, 8h6l:5C, 8i0p:C, 8i0r:C, 8i0s:C, 8i0t:C, 8i0u:C, 8i0v:C, 8i0w:C, 6icz:C, 6id0:C, 6id1:C, 8q7q:C, 8q7v:C, 8q7w:C, 8q7x:C, 8q91:C, 6qdv:C, 8qp8:C, 7qtt:b, 6qw6:5C, 6qx9:5C, 8rc0:C, 7w59:C, 7w5a:C, 7w5b:C, 5xjc:C, 8y6o:D, 5yzg:C, 5z56:C, 5z57:C, 5z58:C, 6zym:B
7	7z67:A	393	24	0.2034	0.0305	0.5000	2.9
8	6dy0:B	231	17	0.1695	0.0433	0.5882	6.5	6dxz:B
9	1foh:C	656	22	0.1695	0.0152	0.4545	6.6	1foh:A, 1foh:B, 1foh:D, 1pn0:A, 1pn0:B, 1pn0:C, 1pn0:D
10	1unf:X	214	33	0.1695	0.0467	0.3030	7.0
11	6dxx:B	231	17	0.1695	0.0433	0.5882	7.1	6dxx:D, 6dxx:F
12	8hxx:N	375	35	0.2373	0.0373	0.4000	7.5	8hxy:N, 8hy0:N, 8i3f:B, 8jho:N, 8tof:G, 8w9c:E, 8w9d:E, 8w9e:E, 8w9f:E
13	2i6k:A	224	34	0.2034	0.0536	0.3529	8.0	2dho:A, 2i6k:B, 2icj:A, 2ick:A

[Back]