Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ

The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1dxg:A 36 36 1.0000 1.0000 1.0000 2.23e-19 1dxg:B, 2lk5:A, 2lk5:B
2 1dfx:A 125 29 0.5000 0.1440 0.6207 1.54e-06
3 2ji2:A 126 28 0.5000 0.1429 0.6429 1.90e-06 2ji1:A, 2ji1:B, 2ji1:C, 2ji1:D, 2ji2:B, 2ji2:C, 2ji2:D, 2ji3:A, 2ji3:B, 2ji3:C, 2ji3:D, 1vzg:A, 1vzg:B, 1vzh:A, 1vzh:B, 1vzi:A, 1vzi:B
4 5oh8:C 46 27 0.2222 0.1739 0.2963 0.61 8aoq:C
5 1q17:C 295 29 0.3056 0.0373 0.3793 3.5 7f4e:A, 7f51:A, 2od2:A, 2od7:A, 2od9:A, 1q14:A, 1q17:A, 1q17:B, 1q1a:A, 2qqf:A, 2qqg:A, 1szc:A, 1szd:A
6 4jnd:A 408 18 0.2778 0.0245 0.5556 4.8
7 8b6h:DD 558 17 0.2222 0.0143 0.4706 7.4 8b6h:Dd, 8bqs:DD, 8bqs:Dd, 8gym:vb, 8gym:VB, 8gzu:29, 8gzu:84, 8gzu:vb, 8gzu:VB, 7w5z:5B, 7w5z:5b
8 1wjp:A 107 25 0.2500 0.0841 0.3600 7.5
9 8eop:A 1687 26 0.3056 0.0065 0.4231 8.9
10 8ee6:A 1808 26 0.3056 0.0061 0.4231 8.9 8edw:A
11 2ba1:A 179 15 0.2500 0.0503 0.6000 9.3 2ba1:C, 2ba1:B, 3m7n:A, 3m7n:B, 3m7n:C, 3m85:A, 3m85:B, 3m85:C

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417