ANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGYNVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATT
DPEGAYETVKKEYKRKWNIVWLKPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMWFLEGPDGYPGLQKLY
NFKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIRQDVLDKHPELKDVLNKLAN
QISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQV
The query sequence (length=278) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7s7x:A | 278 | 278 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7s7x:B, 7s7x:C, 6v1r:A |
2 | 7s7t:A | 509 | 210 | 0.7194 | 0.3929 | 0.9524 | 1.67e-141 | 8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K |
3 | 7s7t:A | 509 | 76 | 0.2662 | 0.1454 | 0.9737 | 1.55e-41 | 8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K |
4 | 3ppo:A | 272 | 271 | 0.4029 | 0.4118 | 0.4133 | 6.73e-65 | 3ppo:B, 3ppq:A, 3ppq:B, 3ppr:A, 3ppr:B |
5 | 7txl:A | 275 | 276 | 0.3777 | 0.3818 | 0.3804 | 2.63e-62 | 7txk:A, 7txk:B, 7txl:B |
6 | 6eyh:A | 280 | 273 | 0.3741 | 0.3714 | 0.3810 | 9.49e-62 | 6eyl:A, 6eyl:B, 5nxy:A, 5nxy:C, 3r6u:A |
7 | 8dp7:A | 265 | 271 | 0.3669 | 0.3849 | 0.3764 | 2.03e-57 | 8dp7:B, 8dp7:C, 8dp7:D, 8dp7:E |
8 | 1sw1:A | 270 | 275 | 0.3885 | 0.4000 | 0.3927 | 1.23e-50 | 1sw1:B, 1sw4:A, 1sw4:B |
9 | 5nxx:C | 265 | 91 | 0.0899 | 0.0943 | 0.2747 | 0.076 | 2b4m:A, 2b4m:B, 3chg:D, 3chg:A, 3chg:B, 3chg:C, 5nxx:D |
10 | 8pjn:b | 296 | 40 | 0.0432 | 0.0405 | 0.3000 | 1.3 | |
11 | 7d6a:B | 477 | 47 | 0.0540 | 0.0314 | 0.3191 | 2.5 | 7d6a:A, 7d6b:A, 7d6b:B |
12 | 2reg:A | 290 | 87 | 0.0755 | 0.0724 | 0.2414 | 5.5 | 2reg:B, 2rin:A, 2rin:B |
13 | 3dy8:A | 328 | 19 | 0.0360 | 0.0305 | 0.5263 | 9.3 | 6a3n:A, 6a3n:B, 8bpy:A, 8bpy:B, 3dy8:B, 3dyl:A, 3dyl:B, 3dyn:A, 3dyn:B, 3dyq:A, 3dys:A, 3dys:B, 4e90:A, 4e90:B, 7f0i:A, 7f0i:B, 4g2j:A, 4g2j:B, 4g2l:A, 4g2l:B, 4gh6:A, 4gh6:B, 2hd1:A, 2hd1:B, 3jsi:A, 3jsi:B, 3jsw:A, 3jsw:B, 3k3e:A, 3k3e:B, 3k3h:A, 3k3h:B, 6lzz:A, 6lzz:B, 3n3z:A, 3n3z:B, 4qge:A, 4qge:B, 3qi3:A, 3qi3:B, 3qi4:A, 3qi4:B, 4y86:A, 4y86:B, 4y87:A, 4y87:B, 4y8c:A, 4y8c:B, 2yy2:A, 2yy2:B |