BioLiP

>protein
AMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPPPVVLVQTLTEPDWSVLDEGYAQVFPPKP
FHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKLLQVQ
AVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP

The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2y8w:A	215	212	1.0000	0.9256	0.9387	1.21e-133	3qrp:A, 3qrq:A, 3qrr:A, 2y8y:A, 2y9h:A, 2y9h:C, 2y9h:E, 2y9h:G, 2y9h:I
2	2y9h:M	193	199	0.9648	0.9948	0.9648	1.10e-129	2y9h:K, 2y9h:O
3	8yha:B	268	266	0.3920	0.2910	0.2932	2.32e-15	8yb6:B
4	5h9f:K	159	199	0.3015	0.3774	0.3015	1.07e-14	5h9e:K
5	5cd4:A	199	215	0.3367	0.3367	0.3116	1.35e-14	5cd4:M, 4tvx:A, 4tvx:M, 4u7u:D, 4u7u:P
6	6c66:O	212	213	0.3266	0.3066	0.3052	5.48e-14	5u0a:A
7	4qyz:K	152	198	0.2864	0.3750	0.2879	1.57e-09
8	5u07:A	190	205	0.3065	0.3211	0.2976	2.02e-08
9	8br4:A	339	76	0.0854	0.0501	0.2237	0.79	8br4:B, 8br4:C, 8br4:D, 8br4:E, 8br4:F, 8br4:G, 8br4:H, 8br4:I, 8br4:J, 8br4:K, 8br4:L, 8br4:M, 8br4:N, 8br4:O, 8br4:P
10	8gz0:B	160	36	0.0754	0.0938	0.4167	1.2	8gz0:A, 7wrk:A, 7wwn:A, 7wwo:A, 7wwo:B
11	7k64:H	348	33	0.0704	0.0402	0.4242	4.4	7jyb:B, 7jyb:D, 7jyb:G, 7k14:H, 7k64:D, 7k64:G
12	7jw9:A	378	33	0.0704	0.0370	0.4242	4.7	7jw9:B, 7jw9:C, 7jw9:D, 7jyb:A, 7jyb:C, 7jyb:E, 7k14:A, 7k14:B, 7k14:C, 7k14:D, 7k14:E, 7k14:G, 7k64:A, 7k64:C, 7k64:E
13	7znp:A	502	52	0.0854	0.0339	0.3269	7.4

[Back]