AMSYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGRAHFESNETIKLLEKILESGIDEKIAIKTINSILSLRI
YSTLDLSIIDLQDASCKFLKVGSTPSFIKRGDQVMKVQASIINEFDVEVVSEQLKAGDLLIMMSDGIFEGPKHVENHDLW
MKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKW
The query sequence (length=210) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3t9q:B | 227 | 219 | 0.9952 | 0.9207 | 0.9543 | 2.31e-148 | 3t91:A, 3t91:B, 3t9q:A |
2 | 3pu9:A | 236 | 217 | 0.2333 | 0.2076 | 0.2258 | 5.74e-04 | 3pu9:B |
3 | 8elf:B | 384 | 87 | 0.1190 | 0.0651 | 0.2874 | 0.065 | 8elf:A |
4 | 8k7p:A | 382 | 68 | 0.1190 | 0.0654 | 0.3676 | 0.10 | 8k7p:B, 8k7q:A, 8k7q:B, 6ksi:A, 6ksi:B, 6ksl:A, 6ksl:B, 6ksm:A, 6ksm:B, 8s9r:A, 8s9r:B, 8yib:A, 8yib:B |
5 | 7yq8:A | 730 | 196 | 0.1952 | 0.0562 | 0.2092 | 0.67 | 7yq8:B, 5zad:A, 5zad:B, 5zen:A, 5zqf:A |
6 | 7qix:R | 150 | 27 | 0.0667 | 0.0933 | 0.5185 | 1.4 | 8auv:W, 8b2l:W1, 7qiz:HA |
7 | 3ujk:A | 298 | 65 | 0.1095 | 0.0772 | 0.3538 | 1.5 | 3nmv:B, 3ujl:B |
8 | 3in1:A | 312 | 21 | 0.0571 | 0.0385 | 0.5714 | 5.6 | 3in1:B |
9 | 4wy0:B | 260 | 61 | 0.1000 | 0.0808 | 0.3443 | 6.5 | 4wy0:D, 4wy0:E, 4wy0:G, 4wy0:I, 4wy0:J, 4wy0:K, 1znn:A, 1znn:B, 1znn:C, 1znn:D, 1znn:E, 1znn:F |
10 | 7xf0:C | 598 | 33 | 0.0714 | 0.0251 | 0.4545 | 9.0 | 7xf0:A, 7xf0:B, 7xf1:A, 7xg3:L, 7xg4:L |