BioLiP

>protein
AMSQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFG
PYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELL
VWYGDEYGQELGI

The query sequence (length=173) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4c1q:A	173	173	1.0000	1.0000	1.0000	5.81e-131	4c1q:B
2	4ijd:A	215	170	0.8844	0.7116	0.9000	4.02e-116	4ijd:B, 6nm4:A, 6nm4:B
3	3ray:A	159	165	0.4335	0.4717	0.4545	1.76e-50
4	2l9z:A	39	28	0.0578	0.2564	0.3571	0.18
5	1e3e:A	376	50	0.0983	0.0452	0.3400	0.64	1e3e:B, 1e3i:A, 1e3i:B, 1e3l:A, 1e3l:B
6	3q1o:A	303	98	0.1387	0.0792	0.2449	3.3	3q1o:B, 3q1o:C, 3q1o:D
7	3lrl:A	452	41	0.0925	0.0354	0.3902	3.5	3lrm:A, 3lrm:B, 3lrm:C, 3lrm:D
8	8sr6:A	451	98	0.1329	0.0510	0.2347	4.6	5czy:A, 8swi:A
9	8gvw:A	671	38	0.0867	0.0224	0.3947	8.8	6aei:A, 6aei:D, 6aei:B, 6aei:C, 7d4p:A, 7d4p:D, 7d4p:B, 7d4p:C, 7d4q:A, 7d4q:D, 7d4q:B, 7d4q:C, 7e4t:A, 7e4t:D, 7e4t:B, 7e4t:C, 8gvw:D, 8gvw:B, 8gvw:C, 7wdb:A, 7wdb:D, 7wdb:B, 7wdb:C
10	7x6i:A	687	38	0.0867	0.0218	0.3947	8.8	8gvx:B, 8gvx:A, 8gvx:D, 8gvx:C, 7x6c:C, 7x6c:B, 7x6c:A, 7x6c:D, 7x6i:D, 7x6i:B, 7x6i:C, 6ysn:A, 6ysn:B, 6ysn:C, 6ysn:D

[Back]