AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVH
LNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGM
YDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSF
CISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK
The query sequence (length=315) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1xov:A | 315 | 315 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 3qay:A | 180 | 179 | 0.1905 | 0.3333 | 0.3352 | 2.41e-17 | 3qay:B, 3qay:C, 3qay:D |
3 | 5j72:A | 638 | 150 | 0.1333 | 0.0658 | 0.2800 | 3.67e-06 | 5j72:B |
4 | 4rn7:A | 186 | 133 | 0.1079 | 0.1828 | 0.2556 | 1.29e-05 | |
5 | 7tj4:B | 176 | 137 | 0.1270 | 0.2273 | 0.2920 | 7.49e-05 | 7tj4:D |
6 | 1jwq:A | 179 | 63 | 0.0540 | 0.0950 | 0.2698 | 3.1 | |
7 | 8esq:K | 251 | 111 | 0.0794 | 0.0996 | 0.2252 | 6.9 | 8esr:K, 8etg:K, 8eth:K, 8eti:K, 8eup:K, 8euy:K, 8ev3:K |
8 | 7nsh:BC | 700 | 38 | 0.0444 | 0.0200 | 0.3684 | 8.1 | 7l20:w |