AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLITQHSNK
VSQFHKTLKNATGKKLLKLQKTCLKNNKIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLPVGVCHGSGPT
AADAQRHAAQNALEYLKIMTKK
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dga:K | 182 | 182 | 1.0000 | 1.0000 | 1.0000 | 7.62e-136 | 8dg7:K |
2 | 8dfv:K | 253 | 182 | 0.7308 | 0.5257 | 0.7308 | 2.98e-85 | 8dg5:K |
3 | 8dfv:K | 253 | 74 | 0.4066 | 0.2925 | 1.0000 | 1.43e-47 | 8dg5:K |
4 | 7zpk:C | 233 | 219 | 0.4121 | 0.3219 | 0.3425 | 3.58e-26 | 3adl:A, 5n8l:A, 5n8m:A |
5 | 4wyq:B | 75 | 67 | 0.1978 | 0.4800 | 0.5373 | 1.66e-15 | 4wyq:E |
6 | 6sdw:A | 177 | 179 | 0.2637 | 0.2712 | 0.2682 | 1.17e-05 | 6htu:A, 6htu:B, 6htu:C, 6sdy:A |
7 | 1yyk:A | 221 | 65 | 0.1319 | 0.1086 | 0.3692 | 2.59e-04 | 2ez6:A, 2ez6:B, 1jfz:A, 1jfz:B, 1jfz:C, 1jfz:D, 4m2z:A, 4m2z:B, 4m30:A, 4m30:B, 2nue:A, 2nuf:A, 2nuf:B, 2nug:A, 2nug:B, 1rc5:A, 1rc5:B, 1rc5:C, 1rc5:D, 1rc7:A, 1yyo:A, 1yyw:A, 1yyw:C, 1yz9:A |
8 | 3vyy:A | 86 | 68 | 0.0934 | 0.1977 | 0.2500 | 0.036 | 3vyy:B |
9 | 7zlq:B | 82 | 74 | 0.1209 | 0.2683 | 0.2973 | 0.037 | 7zlq:A |
10 | 7v6c:B | 260 | 97 | 0.1538 | 0.1077 | 0.2887 | 0.21 | |
11 | 9asp:C | 92 | 88 | 0.1429 | 0.2826 | 0.2955 | 0.32 | |
12 | 7yop:B | 304 | 99 | 0.1264 | 0.0757 | 0.2323 | 0.43 | 8grw:A, 8grw:B, 7yop:A, 7ysz:A, 7ysz:B |
13 | 7r97:A | 226 | 57 | 0.0989 | 0.0796 | 0.3158 | 0.43 | 7r97:B |
14 | 6v5b:C | 217 | 73 | 0.1319 | 0.1106 | 0.3288 | 2.9 | 6v5b:B, 6v5c:C, 6v5c:B |
15 | 9asp:B | 250 | 73 | 0.1319 | 0.0960 | 0.3288 | 3.1 | 9asm:B, 9asn:B, 9asq:B |
16 | 2l3j:A | 236 | 68 | 0.1374 | 0.1059 | 0.3676 | 4.9 | 2l3c:A |
17 | 7z0s:D | 306 | 21 | 0.0604 | 0.0359 | 0.5238 | 5.3 | |
18 | 5z87:A | 756 | 97 | 0.1374 | 0.0331 | 0.2577 | 5.5 | 5z87:B |
19 | 5cd4:I | 494 | 66 | 0.0769 | 0.0283 | 0.2121 | 6.3 | 5cd4:U, 5h9e:A, 5h9f:A, 4tvx:I, 4tvx:U, 4u7u:M |
20 | 8vig:A | 436 | 53 | 0.0824 | 0.0344 | 0.2830 | 8.3 | |
21 | 1am9:C | 82 | 60 | 0.1154 | 0.2561 | 0.3500 | 8.7 | 1am9:D, 1am9:A, 1am9:B |