BioLiP

>protein
AMKKDSKAPCVEVFDERDGCKAAGTQKASGDDGFCVKVSMKAIKMNAAEATSVTKNYNTKLLGAKS

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4lmx:E	66	66	1.0000	1.0000	1.0000	4.63e-43	8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K
2	4lmx:C	66	66	0.8939	0.8939	0.8939	4.59e-37	8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F
3	4lm6:A	62	61	0.5455	0.5806	0.5902	1.49e-18	4lm6:C
4	7s96:A	63	60	0.5455	0.5714	0.6000	7.90e-16	7s96:C, 7s97:C, 7t89:A, 7t89:C
5	7ssf:A	72	47	0.4091	0.3750	0.5745	5.77e-10	7ssf:C, 7ssf:E, 7ssf:G
6	7t7u:C	70	51	0.3333	0.3143	0.4314	1.23e-05
7	7t8s:D	70	66	0.3939	0.3714	0.3939	1.00e-04	7t8s:H, 7t8s:L, 7t8s:P
8	7t7u:A	81	55	0.3030	0.2469	0.3636	1.06e-04
9	4lms:A	80	54	0.3485	0.2875	0.4259	4.93e-04
10	7tja:G	67	61	0.3788	0.3731	0.4098	0.003	7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
11	7t8s:B	78	56	0.3333	0.2821	0.3929	0.003	7t8s:F, 7t8s:J, 7t8s:N
12	7sut:A	78	58	0.3333	0.2821	0.3793	0.016	7sut:E
13	1qgw:A	76	64	0.3030	0.2632	0.3125	0.016	1xf6:A, 1xg0:A
14	1qgw:B	67	58	0.3030	0.2985	0.3448	0.057	1xf6:B, 1xg0:B
15	7tja:I	75	42	0.2576	0.2267	0.4048	0.072	7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
16	7x2u:A	541	33	0.1515	0.0185	0.3030	5.3	7x2u:B
17	2lua:A	52	29	0.1061	0.1346	0.2414	7.4	4rkg:B, 4rkh:D, 4rkh:E, 4rkh:C, 4rkh:F
18	6kz8:A	784	43	0.2121	0.0179	0.3256	8.3	6kz8:B, 6kz9:A

[Back]