BioLiP

>protein
AMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNC
GRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTL
I

The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1jpl:A	161	161	1.0000	1.0000	1.0000	2.02e-120	1jpl:B, 1jpl:C, 1jpl:D, 1juq:A, 1juq:B, 1juq:C, 1juq:D, 1lf8:A, 1lf8:B, 1lf8:C, 1lf8:D
2	3g2s:A	146	142	0.6398	0.7055	0.7254	5.76e-77	3g2s:B, 3g2t:A, 3g2t:B, 3g2u:A, 3g2u:B, 3g2v:A, 3g2v:B, 3g2w:A, 3g2w:B, 1jwg:A, 1jwg:B, 1py1:A, 1py1:B, 1py1:C, 1py1:D, 1ujj:A, 1ujk:A, 1ujk:B
3	4avx:A	218	156	0.2919	0.2156	0.3013	1.14e-14	3zyq:A
4	1dvp:A	217	133	0.2733	0.2028	0.3308	3.83e-13
5	6ohb:A	435	29	0.0994	0.0368	0.5517	0.51	6ohb:B, 6ohb:C, 6ohb:D, 6ohc:A, 6ohc:B, 6ohc:C, 6ohc:D
6	6c94:A	482	48	0.0932	0.0311	0.3125	2.0	6c93:A, 5t6q:A
7	6bni:A	502	45	0.0932	0.0299	0.3333	2.7	6bni:B, 6c86:A, 6c86:B, 5eln:A, 5eln:B, 5eln:C, 5eln:D, 5elo:A, 5elo:B, 5elo:C, 5elo:D, 6hcw:A, 6hcw:B, 7zog:A, 7zog:B, 7zog:C, 7zog:D
8	4do4:B	400	73	0.1056	0.0425	0.2329	4.4	4do4:A, 4do5:A, 4do5:B, 4do6:A, 4do6:B, 3h55:A, 3h55:B, 3igu:A, 3igu:B
9	5gj3:A	270	45	0.0932	0.0556	0.3333	7.2	5y8b:A
10	8b6h:DD	558	53	0.0994	0.0287	0.3019	8.9	8b6h:Dd, 8bqs:DD, 8bqs:Dd, 8gym:vb, 8gym:VB, 8gzu:29, 8gzu:84, 8gzu:vb, 8gzu:VB, 7w5z:5B, 7w5z:5b
11	7lar:D	183	54	0.0932	0.0820	0.2778	9.5	7lar:E, 7lar:A, 7lar:B, 7lar:C, 7las:D, 7las:E, 7las:A, 7las:B, 7las:C
12	6sl1:A	2652	33	0.0683	0.0041	0.3333	9.6	6sky:A, 6sky:B

[Back]