AMDIVFIEELSVITTIGVYDWEQTIQQKLVFDIEMGWDNRKAAGSDDVNDCLSFADISEAVIQHVGSQRFALVERVAEEV
AELLLRRFNSPWVRIKVSKPGAVAQAKNVGVIIERGQ
The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7su7:D | 119 | 117 | 0.9915 | 0.9748 | 0.9915 | 3.04e-82 | 6ojo:A, 6ojo:C, 6ojo:B, 6ojo:D, 7su4:A, 7su4:D, 7su4:B, 7su4:C, 7su6:A, 7su6:C, 7su6:B, 7su6:D, 7su7:B, 7su7:A, 7su7:C, 7su8:A, 7su8:B |
2 | 2o90:A | 115 | 115 | 0.8376 | 0.8522 | 0.8522 | 7.31e-69 | |
3 | 5f3m:A | 120 | 114 | 0.2564 | 0.2500 | 0.2632 | 3.97e-09 | 5f3m:B, 5far:A, 5far:B, 5far:C, 5far:D, 5far:E, 5far:H, 5far:F, 5far:G, 8sv5:A, 8sv5:G, 8sv5:B, 8sv5:H, 8sv5:C, 8sv5:D, 8sv5:F, 8sv5:E |
4 | 1nbu:A | 118 | 117 | 0.2906 | 0.2881 | 0.2906 | 3.96e-07 | 1nbu:D, 1nbu:B, 1nbu:C, 1nbu:E, 1nbu:H, 1nbu:F, 1nbu:G |
5 | 4xeq:B | 304 | 34 | 0.1197 | 0.0461 | 0.4118 | 1.1 | 4xeq:A, 4xeq:C, 4xeq:D |
6 | 8evk:A | 115 | 96 | 0.1538 | 0.1565 | 0.1875 | 1.3 | |
7 | 7u5a:A | 323 | 54 | 0.1538 | 0.0557 | 0.3333 | 1.6 | 7u1o:A, 7u1o:B, 7u5a:B, 7u91:A, 7u91:B, 7ulc:A, 7ulc:B |
8 | 7qoe:A | 187 | 40 | 0.1026 | 0.0642 | 0.3000 | 5.2 | |
9 | 8bqa:AAA | 298 | 70 | 0.1453 | 0.0570 | 0.2429 | 6.5 | |
10 | 3ivd:A | 499 | 38 | 0.0940 | 0.0220 | 0.2895 | 7.7 | 3ivd:B, 3ive:A |