AMARGVNKVILIGNLGDDPELRYTGSGTAVCNMSLATNETNTEWHDVVAWGRLGEICNEYLDKGSQVYFEGKLQTRSWED
RDNNTRYSTEVKAQEMMFL
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5odn:D | 106 | 100 | 1.0000 | 0.9340 | 0.9900 | 6.91e-70 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
2 | 5odp:G | 100 | 107 | 0.8384 | 0.8300 | 0.7757 | 1.05e-51 | 5odp:A |
3 | 1eqq:B | 120 | 100 | 0.5556 | 0.4583 | 0.5500 | 1.64e-34 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
4 | 6irq:C | 104 | 94 | 0.5455 | 0.5192 | 0.5745 | 1.20e-31 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
5 | 6bhx:C | 102 | 96 | 0.4040 | 0.3922 | 0.4167 | 1.11e-20 | 6bhx:A, 6bhx:B |
6 | 8gw5:A | 99 | 95 | 0.3535 | 0.3535 | 0.3684 | 7.92e-17 | 7ym1:A |
7 | 7dep:B | 102 | 102 | 0.3939 | 0.3824 | 0.3824 | 6.17e-16 | |
8 | 3ulp:C | 116 | 100 | 0.3232 | 0.2759 | 0.3200 | 2.62e-15 | 3ulp:A, 3ulp:B, 3ulp:D |
9 | 6rup:A | 111 | 110 | 0.3636 | 0.3243 | 0.3273 | 4.27e-15 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
10 | 2vw9:A | 108 | 103 | 0.3636 | 0.3333 | 0.3495 | 1.93e-14 | 2vw9:B |
11 | 3vdy:A | 101 | 101 | 0.3737 | 0.3663 | 0.3663 | 2.81e-14 | 3vdy:B |
12 | 3udg:C | 214 | 100 | 0.4242 | 0.1963 | 0.4200 | 1.62e-13 | 3udg:B, 3udg:A |
13 | 3udg:C | 214 | 84 | 0.3030 | 0.1402 | 0.3571 | 1.34e-08 | 3udg:B, 3udg:A |
14 | 8uzt:B | 100 | 105 | 0.3434 | 0.3400 | 0.3238 | 9.50e-12 | |
15 | 3a5u:A | 118 | 104 | 0.3636 | 0.3051 | 0.3462 | 1.27e-11 | 3a5u:B |
16 | 5t7e:D | 175 | 49 | 0.1616 | 0.0914 | 0.3265 | 0.53 | 5t7d:A, 5t7d:B, 5t7d:C, 5t7d:D, 5t7e:A, 5t7e:B, 5t7e:C |
17 | 6iun:B | 692 | 36 | 0.1111 | 0.0159 | 0.3056 | 0.81 | 6iun:A |
18 | 5gqo:A | 97 | 57 | 0.1818 | 0.1856 | 0.3158 | 2.4 | |
19 | 7suk:6 | 277 | 28 | 0.1010 | 0.0361 | 0.3571 | 4.0 | 7d63:RB, 6ke6:RB, 6lqp:RB, 6lqq:RB, 6lqr:RB, 6lqu:RB, 6lqv:RB, 5wlc:NC, 6zqb:JE |
20 | 6l1x:A | 708 | 38 | 0.1313 | 0.0184 | 0.3421 | 5.6 | |
21 | 6l3h:A | 741 | 38 | 0.1313 | 0.0175 | 0.3421 | 5.6 | 6l3h:B |
22 | 4rku:G | 84 | 16 | 0.0909 | 0.1071 | 0.5625 | 5.7 | |
23 | 5zji:G | 97 | 16 | 0.0909 | 0.0928 | 0.5625 | 5.9 | |
24 | 7bcb:B | 97 | 24 | 0.1010 | 0.1031 | 0.4167 | 8.2 | 7bca:A, 7bca:B, 7bcb:A |