BioLiP

>protein
AMAKGVGVSNEKLDAVMRVVSEESGIALEELTDDSNFADMGIDSLSSMVIGSRFREDLGLDLGPEFSLFIDCTTVRALKD
FMLGSGDAG

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2kr5:A	89	89	1.0000	1.0000	1.0000	1.54e-58
2	8cg6:C	75	63	0.3596	0.4267	0.5079	7.58e-16
3	5hv8:A	95	54	0.2022	0.1895	0.3333	2.83e-04
4	2vsq:A	1273	84	0.2472	0.0173	0.2619	0.013
5	8odw:A	612	67	0.1685	0.0245	0.2239	0.028	8odw:B
6	2eht:A	77	53	0.1685	0.1948	0.2830	0.067
7	2fq1:A	279	28	0.1236	0.0394	0.3929	0.34
8	3rg2:C	613	28	0.1236	0.0179	0.3929	0.37	6iyk:A, 6iyk:B, 6iyl:A, 6iyl:B, 4iz6:A, 4iz6:B, 8k5s:A, 8k5s:B, 8k5t:A, 8k5t:B, 3rg2:A, 3rg2:B, 3rg2:H, 3rg2:D, 3rg2:E, 3rg2:F, 3rg2:I, 3rg2:G, 3rg2:J
9	7aib:C	267	40	0.1348	0.0449	0.3000	0.71	7aic:C
10	6kfu:A	527	64	0.1573	0.0266	0.2188	0.83	6kfm:A, 6kfm:B, 6kfr:A, 6kfr:B
11	8g3i:B	515	34	0.1461	0.0252	0.3824	1.1
12	8b37:B	681	31	0.1348	0.0176	0.3871	1.1	8b37:A
13	8bee:U	87	53	0.1798	0.1839	0.3019	1.2	7aqr:U, 7arb:U, 8bpx:U, 8bq5:U, 8bq6:U
14	6tix:BBB	533	42	0.2022	0.0338	0.4286	1.7	6tix:AAA
15	6ltb:A	928	34	0.1348	0.0129	0.3529	4.5	6ltc:A, 6ltd:A, 6ltd:B
16	2qnw:A	80	54	0.1910	0.2125	0.3148	4.7
17	2liw:A	99	59	0.1573	0.1414	0.2373	5.6
18	7ut5:A	324	47	0.1573	0.0432	0.2979	5.7	7ut5:B
19	7orj:A	2129	29	0.1461	0.0061	0.4483	6.2
20	2koo:A	81	46	0.1685	0.1852	0.3261	7.1	2kop:A, 2koq:A, 2kor:A, 2kos:A
21	1gud:A	288	34	0.1461	0.0451	0.3824	10.0	1rpj:A, 8wl7:A, 8wl9:A, 8wlb:A

[Back]