BioLiP

>protein
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYV

The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3hd7:B	98	54	1.0000	0.5510	1.0000	5.28e-34	3rk2:B, 5w5c:B
2	1l4a:B	82	53	0.8148	0.5366	0.8302	3.95e-28
3	1fio:A	190	33	0.3148	0.0895	0.5152	7.30e-05
4	1kc7:A	872	42	0.2407	0.0149	0.3095	0.13
5	4rew:A	411	39	0.3148	0.0414	0.4359	1.00
6	4zhx:A	409	36	0.2963	0.0391	0.4444	1.1	4cfe:C
7	6c9g:A	386	39	0.3148	0.0440	0.4359	1.1	6c9f:A, 6c9j:A, 6e4t:A, 6e4u:A, 6e4w:A, 7jhg:A, 5kq5:A, 7m74:A, 4qfg:A, 4qfr:A, 4qfs:A, 5t5t:A, 5ufu:A
8	6b1u:A	442	36	0.2963	0.0362	0.4444	1.2	4cfe:A, 4cff:A, 4cff:C, 5ezv:A, 5ezv:C, 5iso:C, 7myj:A
9	7myj:C	465	36	0.2963	0.0344	0.4444	1.2	3aqv:A, 6b1u:C, 6b2e:A, 8bik:A, 8bik:D, 5iso:A, 4zhx:C
10	6c9h:A	435	39	0.3148	0.0391	0.4359	1.2	4cfh:A
11	4rer:A	459	39	0.3148	0.0370	0.4359	1.3
12	6bx6:A	243	36	0.2963	0.0658	0.4444	3.2
13	6ywo:A	354	49	0.2593	0.0395	0.2857	4.8	6ywn:A, 6ywo:B, 6ywo:C, 6ywo:D
14	8qeo:A	2146	44	0.2222	0.0056	0.2727	4.9
15	8qen:A	2363	44	0.2222	0.0051	0.2727	5.1	9bja:A, 9bja:B, 2bvl:A, 2bvm:A, 6c0b:A, 7lou:A, 7lou:B, 7lov:A, 7lov:B, 3pa8:A, 3pa8:B, 3pee:B, 3pee:A, 7s0y:A, 5uqm:A, 5uqn:A, 5uqt:A, 5uqt:B
16	8y9b:B	1607	44	0.2222	0.0075	0.2727	5.3
17	7u0h:q	189	29	0.1667	0.0476	0.3103	7.1
18	4cys:A	534	25	0.1481	0.0150	0.3200	8.2	5aj9:A, 5aj9:B, 4cxk:A, 4cxk:B, 4cxs:A, 4cxs:B, 4cxu:A, 4cxu:B, 4cyr:A, 4cyr:B, 4cys:B, 1hdh:A, 1hdh:B
19	3lv0:A	258	43	0.2222	0.0465	0.2791	8.4	3luz:A, 3lv0:B
20	3luz:B	234	43	0.2222	0.0513	0.2791	8.7

[Back]