BioLiP

>protein
ALLLQEAQAGFCRVDGTIDNNHTGFTGSGFANTNNAQGAAVVWAIDATSSGRRTLTIRYANGGTANRNGSLVINGGSNGN
YTVSLPTTGAWTTWQTATIDVDLVQGNNIVQLSATTAEGLPNIDSLSVVGGTVRAGNCG

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2w87:A	139	139	1.0000	1.0000	1.0000	5.35e-96	2w46:A, 2w46:B, 2w87:B
2	2w3j:A	137	136	0.4245	0.4307	0.4338	1.60e-35
3	2vzp:B	127	115	0.3165	0.3465	0.3826	2.11e-22	2vzp:A, 2vzq:A, 2vzq:B, 2vzr:A, 2vzr:B
4	2w47:A	135	105	0.3237	0.3333	0.4286	1.42e-21	2w1w:A, 2w1w:B
5	4qaw:A	537	128	0.3237	0.0838	0.3516	2.10e-12	4qaw:B, 4qaw:C, 4qaw:D, 4qaw:E, 4qaw:F, 4qaw:G, 4qaw:H, 4qb1:A, 4qb2:A, 4qb6:A
6	5x7o:A	1247	93	0.2518	0.0281	0.3763	1.56e-11	5x7o:B, 5x7p:B, 5x7p:A, 5x7q:A, 5x7q:B, 5x7r:A, 5x7r:B, 5x7s:A, 5x7s:B
7	5x7o:A	1247	110	0.2230	0.0249	0.2818	4.28e-06	5x7o:B, 5x7p:B, 5x7p:A, 5x7q:A, 5x7q:B, 5x7r:A, 5x7r:B, 5x7s:A, 5x7s:B
8	3wnk:A	712	110	0.2734	0.0534	0.3455	5.52e-09	3wnl:A, 3wnm:A, 3wnn:A, 3wnn:B, 3wno:A, 3wno:B, 3wnp:A, 3wnp:B
9	5hxm:A	1060	95	0.2374	0.0311	0.3474	1.35e-08	5f7u:A, 5hpo:A, 5i0d:A, 5i0d:B, 4kmq:A, 4kwu:A
10	5x7g:A	700	115	0.2734	0.0543	0.3304	7.85e-08	5x7h:A
11	2wz8:A	135	89	0.1942	0.2000	0.3034	1.41e-04
12	1uyy:A	131	72	0.1655	0.1756	0.3194	0.071	1uy0:A, 1uy0:B, 1uyx:A, 1uyx:B, 1uyy:B, 1uyz:A, 1uyz:B, 1uz0:A
13	5awp:A	596	104	0.2158	0.0503	0.2885	0.097	5awq:A
14	1w9t:A	134	53	0.1367	0.1418	0.3585	0.25	1w9t:B, 1w9w:A
15	5g56:A	707	107	0.2302	0.0453	0.2991	1.2	5la0:A, 5la1:A, 5la2:A, 5la2:B, 2y8k:A
16	2q3d:A	306	79	0.1655	0.0752	0.2911	1.5	2q3c:A, 3zei:A
17	3a22:A	614	101	0.2158	0.0489	0.2970	3.3	3a22:B, 3a23:A, 3a23:B
18	2r42:A	383	88	0.1655	0.0601	0.2614	3.3	1kvk:A
19	8cgq:A	458	36	0.1007	0.0306	0.3889	5.5	6lf6:A
20	6bqw:A	275	53	0.1295	0.0655	0.3396	6.6	6bqw:B, 6bqw:C, 6bqw:D, 6bqw:E, 6bqw:F, 6bqw:G, 6bqw:H, 6bqw:I, 6f95:A, 6f95:B, 6f95:C, 6f95:D, 6f95:E
21	1ahu:A	555	79	0.1655	0.0414	0.2911	6.9	1ahu:B, 1ahv:A, 1ahv:B, 1ahz:A, 1ahz:B, 1dzn:A, 1dzn:B, 1e0y:A, 1e0y:B, 1e8g:A, 1e8g:B, 1e8h:A, 1e8h:B, 5mxj:A, 5mxj:B, 5mxu:A, 5mxu:B, 1qlt:A, 1qlt:B, 1qlu:A, 1qlu:B, 1vao:A, 1vao:B, 2vao:A, 2vao:B, 1w1j:A, 1w1j:B, 1w1k:A, 1w1k:B, 1w1l:A, 1w1l:B, 1w1m:A, 1w1m:B
22	3zm8:A	444	61	0.1079	0.0338	0.2459	7.6

[Back]