BioLiP

>protein
ALKDPEVCTDPFRLTTHAMGVNIYKEGQDVVLKPDSEYPEWLFEMNVGPPKKLEELDPETREYWRLLRKHNIWRHNRLSK
NRKF

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ydp:Bq	85	84	1.0000	0.9882	1.0000	1.03e-59	5aj4:Bq, 6gaw:Bq, 6gb2:Bq, 7nqh:Bq, 7nql:Bq, 7nsh:Bq, 7nsi:Bq, 7nsj:Bq, 8oin:Bc, 8oiq:Bc, 6ydw:Bq
2	8k2a:L4	83	83	0.8214	0.8313	0.8313	1.96e-49	8any:l, 6i9r:l, 8k2b:L4, 7l08:l, 7l20:l, 7o9k:l, 7o9m:l, 7odr:l, 7ods:l, 7odt:l, 7og4:l, 8oir:Bc, 8oit:Bc, 7po4:l, 7qi4:l, 7qi5:l, 7qi6:l, 6vlz:l, 6vmi:l, 8xt0:L4, 8xt1:L4, 8xt2:L4, 8xt3:L4, 6zm5:l, 6zm6:l, 6zs9:l, 6zsa:l, 6zsb:l, 6zsc:l, 6zsd:l, 6zse:l, 6zsg:l
3	8pk0:l	72	19	0.1786	0.2083	0.7895	5.43e-05
4	6ywe:i	124	27	0.1667	0.1129	0.5185	0.026	6yws:i, 6ywv:i, 6ywx:i, 6ywy:i
5	9f17:A	413	27	0.1429	0.0291	0.4444	2.2	9f17:B, 7pvo:A, 8qwa:A, 6zxq:A
6	7uch:A	636	60	0.2024	0.0267	0.2833	3.0	6b39:A, 6b3a:A, 6b3b:A
7	8jxj:A	570	25	0.1071	0.0158	0.3600	6.0	8jxj:B
8	8em7:A	4378	25	0.1071	0.0021	0.3600	6.5	8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B
9	8em4:A	3818	25	0.1071	0.0024	0.3600	7.1	8em4:B
10	5n4b:A	722	16	0.0714	0.0083	0.3750	7.4	5n4b:B, 5n4d:A, 5n4d:B
11	6z1p:AN	96	64	0.2143	0.1875	0.2812	7.5
12	3ahm:A	564	22	0.1190	0.0177	0.4545	9.2	3ahm:B, 3ahn:A, 3ahn:B, 3aho:A, 3aho:B

[Back]