ALFSCFRCGYMYEFAVSNSYCRKLTLRNDHCPRCDQLTLFRFMSVSGMVGNMPFKPIGVPGPSYATLWWRKTREGKEASA
PLDAVCKSDRW
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aoi:Bh | 91 | 91 | 1.0000 | 1.0000 | 1.0000 | 4.39e-66 | 6hiv:Bh, 6hix:Bh, 6yxy:Bh |
2 | 7aih:BG | 85 | 74 | 0.5495 | 0.5882 | 0.6757 | 1.63e-34 | 7am2:BG, 7ane:BG |
3 | 7zq9:9 | 186 | 47 | 0.1538 | 0.0753 | 0.2979 | 1.9 | 7bgi:9, 7d0j:9, 7dz7:9, 7dz8:9, 6ijo:9, 7zq9:92, 7zqd:9, 7zqd:92 |
4 | 8fhj:C | 532 | 22 | 0.0989 | 0.0169 | 0.4091 | 2.3 | 8fhj:A, 8fhj:B |
5 | 2qvh:A | 311 | 45 | 0.1538 | 0.0450 | 0.3111 | 3.0 | 2qvh:B |
6 | 2v9k:A | 467 | 35 | 0.1319 | 0.0257 | 0.3429 | 3.2 | |
7 | 6sl5:6 | 178 | 39 | 0.1319 | 0.0674 | 0.3077 | 4.7 | |
8 | 6uio:B | 110 | 47 | 0.1538 | 0.1273 | 0.2979 | 6.0 | |
9 | 1f8v:A | 355 | 39 | 0.1429 | 0.0366 | 0.3333 | 7.0 | 1f8v:B, 1f8v:C |
10 | 4wsi:A | 372 | 15 | 0.0879 | 0.0215 | 0.5333 | 7.4 | 7m4r:A, 7ntj:B, 7ntj:A, 7ntk:A, 7ntk:D, 7ntk:B, 7ntk:F, 7qcs:A, 7qcs:B, 4uu5:A, 4wsi:B |
11 | 1f76:A | 336 | 28 | 0.1099 | 0.0298 | 0.3571 | 8.6 | 1f76:B, 1f76:D, 1f76:E, 7t5k:A, 7t5k:B, 7t5y:A, 7t5y:B, 7t6c:A, 7t6c:B, 7t6h:A, 7t6h:B |